Details of the Target
General Information of Target
Target ID | LDTP06197 | |||||
---|---|---|---|---|---|---|
Target Name | Voltage-gated potassium channel subunit beta-1 (KCNAB1) | |||||
Gene Name | KCNAB1 | |||||
Gene ID | 7881 | |||||
Synonyms |
KCNA1B; Voltage-gated potassium channel subunit beta-1; EC 1.1.1.-; K(+) channel subunit beta-1; Kv-beta-1 |
|||||
3D Structure | ||||||
Sequence |
MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQL
ALLREVEMNWYLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEV AERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTS RWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLAC GIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV AWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Shaker potassium channel beta subunit family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Cytoplasmic potassium channel subunit that modulates the characteristics of the channel-forming alpha-subunits. Modulates action potentials via its effect on the pore-forming alpha subunits. Promotes expression of the pore-forming alpha subunits at the cell membrane, and thereby increases channel activity. Mediates closure of delayed rectifier potassium channels by physically obstructing the pore via its N-terminal domain and increases the speed of channel closure for other family members. Promotes the closure of KCNA1, KCNA2 and KCNA5 channels . Accelerates KCNA4 channel closure. Accelerates the closure of heteromeric channels formed by KCNA1 and KCNA4. Accelerates the closure of heteromeric channels formed by KCNA2, KCNA5 and KCNA6. Isoform KvB1.2 has no effect on KCNA1, KCNA2 or KCNB1. Enhances KCNB1 and KCNB2 channel activity. Binds NADPH; this is required for efficient down-regulation of potassium channel activity. Has NADPH-dependent aldoketoreductase activity. Oxidation of the bound NADPH strongly decreases N-type inactivation of potassium channel activity.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
PAL-AfBPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [1] |
The Interaction Atlas With This Target