Details of the Target

General Information of Target

Target ID LDTP06131
Target Name Enhancer of filamentation 1 (NEDD9)
Gene Name NEDD9
Gene ID 4739
Synonyms
CASL; Enhancer of filamentation 1; hEF1; CRK-associated substrate-related protein; CAS-L; CasL; Cas scaffolding protein family member 2; CASS2; Neural precursor cell expressed developmentally down-regulated protein 9; NEDD-9; Renal carcinoma antigen NY-REN-12; p105) [Cleaved into: Enhancer of filamentation 1 p55]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIP
PSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKD
YDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPN
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRD
LVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELI
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHN
KALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQDIRNKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF
Target Type
Literature-reported
Target Bioclass
Other
Family
CAS family
Subcellular location
Cytoplasm, cell cortex; Cytoplasm, cytoskeleton, spindle
Function
Scaffolding protein which plays a central coordinating role for tyrosine-kinase-based signaling related to cell adhesion. As a focal adhesion protein, plays a role in embryonic fibroblast migration. May play an important role in integrin beta-1 or B cell antigen receptor (BCR) mediated signaling in B- and T-cells. Integrin beta-1 stimulation leads to recruitment of various proteins including CRKL and SHPTP2 to the tyrosine phosphorylated form. Promotes adhesion and migration of lymphocytes; as a result required for the correct migration of lymphocytes to the spleen and other secondary lymphoid organs. Plays a role in the organization of T-cell F-actin cortical cytoskeleton and the centralization of T-cell receptor microclusters at the immunological synapse. Negatively regulates cilia outgrowth in polarized cysts. Modulates cilia disassembly via activation of AURKA-mediated phosphorylation of HDAC6 and subsequent deacetylation of alpha-tubulin. Positively regulates RANKL-induced osteoclastogenesis. Required for the maintenance of hippocampal dendritic spines in the dentate gyrus and CA1 regions, thereby involved in spatial learning and memory.
TTD ID
T42890
Uniprot ID
Q14511
DrugMap ID
TT1UREA
Ensemble ID
ENST00000379433.5
HGNC ID
HGNC:7733

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
A3KAW SNV: p.A821V .
AN3CA SNV: p.L763V .
DEL SNV: p.D628Y .
FTC133 SNV: p.Q597K .
HT115 SNV: p.K678T .
MDAMB468 SNV: p.G569R .
MOLT4 SNV: p.V120I; p.A316T .
NCIH358 SNV: p.F824L .
RKO SNV: p.S827F .
SHP77 SNV: p.D630E .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K825(1.08)  LDD0277  [1]
DBIA
 Probe Info  		C281(2.05)  LDD3367  [2]
IA-alkyne
 Probe Info  		C525(6.59)  LDD1705  [3]
Acrolein
 Probe Info  		N.A.  LDD0226  [4]
NAIA_5
 Probe Info  		N.A.  LDD2223  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0632  CL-Sc Hep-G2 C475(1.73); C525(0.79)  LDD2227  [5]
 LDCM0625  F8 Ramos C18(0.63)  LDD2187  [6]
 LDCM0572  Fragment10 Ramos C18(1.19)  LDD2189  [6]
 LDCM0573  Fragment11 Ramos C18(0.14)  LDD2190  [6]
 LDCM0574  Fragment12 Ramos C18(0.84)  LDD2191  [6]
 LDCM0575  Fragment13 Ramos C18(0.70)  LDD2192  [6]
 LDCM0576  Fragment14 Ramos C18(0.77)  LDD2193  [6]
 LDCM0579  Fragment20 Ramos C18(0.56)  LDD2194  [6]
 LDCM0580  Fragment21 Ramos C18(0.68)  LDD2195  [6]
 LDCM0582  Fragment23 Ramos C18(0.72)  LDD2196  [6]
 LDCM0578  Fragment27 Ramos C18(0.49)  LDD2197  [6]
 LDCM0586  Fragment28 Ramos C18(0.93)  LDD2198  [6]
 LDCM0588  Fragment30 Ramos C18(0.91)  LDD2199  [6]
 LDCM0589  Fragment31 Ramos C18(0.75)  LDD2200  [6]
 LDCM0590  Fragment32 Ramos C18(1.07)  LDD2201  [6]
 LDCM0468  Fragment33 Ramos C18(0.89)  LDD2202  [6]
 LDCM0596  Fragment38 Ramos C18(0.47)  LDD2203  [6]
 LDCM0566  Fragment4 Ramos C18(0.97)  LDD2184  [6]
 LDCM0610  Fragment52 Ramos C18(1.07)  LDD2204  [6]
 LDCM0614  Fragment56 Ramos C18(0.84)  LDD2205  [6]
 LDCM0569  Fragment7 Ramos C18(1.86)  LDD2186  [6]
 LDCM0571  Fragment9 Ramos C18(0.93)  LDD2188  [6]
 LDCM0022  KB02 Ramos C18(1.29)  LDD2182  [6]
 LDCM0023  KB03 Ramos C18(0.61)  LDD2183  [6]
 LDCM0024  KB05 NUGC-3 C281(2.05)  LDD3367  [2]
 LDCM0109  NEM HeLa N.A.  LDD0226  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Exosome complex component RRP43 (EXOSC8) RNase PH family Q96B26
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Peroxisomal membrane protein PEX14 (PEX14) Peroxin-14 family O75381
Transcription factor
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Protein FosB (FOSB) BZIP family P53539
Zinc finger protein 76 (ZNF76) Krueppel C2H2-type zinc-finger protein family P36508
NF-kappa-B inhibitor alpha (NFKBIA) NF-kappa-B inhibitor family P25963
DNA-binding protein RFX6 (RFX6) RFX family Q8HWS3
LIM/homeobox protein Lhx8 (LHX8) . Q68G74
Proto-oncogene c-Rel (REL) . Q04864
T-box transcription factor TBX19 (TBX19) . O60806
Other
Click To Hide/Show 13 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein BANP (BANP) BANP/SMAR1 family Q8N9N5
Cdc42 effector protein 2 (CDC42EP2) BORG/CEP family O14613
Protein INCA1 (INCA1) INCA family Q0VD86
Keratin, type I cuticular Ha2 (KRT32) Intermediate filament family Q14532
NGFI-A-binding protein 2 (NAB2) NAB family Q15742
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3) PI3K p85 subunit family Q92569
Proline-rich protein 20C (PRR20C) PRR20 family P86479
Thyroid receptor-interacting protein 6 (TRIP6) Zyxin/ajuba family Q15654
Breast cancer anti-estrogen resistance protein 3 (BCAR3) . O75815
Developmental pluripotency-associated protein 4 (DPPA4) . Q7L190
PML-RARA-regulated adapter molecule 1 (PRAM1) . Q96QH2
RNA-binding protein with multiple splicing (RBPMS) . Q93062

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578