Details of the Target
General Information of Target
| Target ID | LDTP05935 | |||||
|---|---|---|---|---|---|---|
| Target Name | GRB2-related adapter protein (GRAP) | |||||
| Gene Name | GRAP | |||||
| Gene ID | 10750 | |||||
| Synonyms |
GRB2-related adapter protein |
|||||
| 3D Structure | ||||||
| Sequence |
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPW
YSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFL WEEKFNSLNELVDFYRTTTIAKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFR RGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GRB2/sem-5/DRK family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | Couples signals from receptor and cytoplasmic tyrosine kinases to the Ras signaling pathway. Plays a role in the inner ear and in hearing. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C161(5.31) | LDD3339 | [1] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0150 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase TRIM21 (TRIM21) | TRIM/RBCC family | P19474 | |||
| Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10) | . | O14672 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Thymocyte selection-associated high mobility group box protein TOX (TOX) | High motility group (HMG) box superfamily | O94900 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Developmental pluripotency-associated protein 4 (DPPA4) | . | Q7L190 | |||
| RNA-binding protein with multiple splicing (RBPMS) | . | Q93062 | |||
References



