Details of the Target

General Information of Target

Target ID LDTP05928
Target Name Lysosomal-associated transmembrane protein 5 (LAPTM5)
Gene Name LAPTM5
Gene ID 7805
Synonyms
KIAA0085; Lysosomal-associated transmembrane protein 5; Lysosomal-associated multitransmembrane protein 5; Retinoic acid-inducible E3 protein
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI
ADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAY
LKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP
HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYE
EALSLPSKTPEGGPAPPPYSEV
Target Bioclass
Transporter and channel
Family
LAPTM4/LAPTM5 transporter family
Subcellular location
Lysosome membrane
Function May have a special functional role during embryogenesis and in adult hematopoietic cells.
Uniprot ID
Q13571
Ensemble ID
ENST00000294507.4
HGNC ID
HGNC:29612

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C218(3.28)  LDD0304  [1]
DBIA
 Probe Info  		C218(2.00)  LDD2351  [2]
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [3]
NAIA_4
 Probe Info  		N.A.  LDD2226  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C218(1.10)  LDD2187  [5]
 LDCM0573  Fragment11 Ramos C218(0.12)  LDD2190  [5]
 LDCM0574  Fragment12 Ramos C218(4.00)  LDD2191  [5]
 LDCM0575  Fragment13 Ramos C218(1.39)  LDD2192  [5]
 LDCM0580  Fragment21 Ramos C218(1.18)  LDD2195  [5]
 LDCM0582  Fragment23 Ramos C218(0.80)  LDD2196  [5]
 LDCM0578  Fragment27 Ramos C218(1.02)  LDD2197  [5]
 LDCM0586  Fragment28 Ramos C218(0.74)  LDD2198  [5]
 LDCM0588  Fragment30 Ramos C218(1.81)  LDD2199  [5]
 LDCM0589  Fragment31 Ramos C218(1.03)  LDD2200  [5]
 LDCM0590  Fragment32 Ramos C218(1.04)  LDD2201  [5]
 LDCM0468  Fragment33 Ramos C218(1.58)  LDD2202  [5]
 LDCM0596  Fragment38 Ramos C218(2.24)  LDD2203  [5]
 LDCM0610  Fragment52 Ramos C218(2.31)  LDD2204  [5]
 LDCM0614  Fragment56 Ramos C218(1.07)  LDD2205  [5]
 LDCM0022  KB02 HEL C218(2.00)  LDD2351  [2]
 LDCM0023  KB03 HEL C218(2.22)  LDD2768  [2]
 LDCM0024  KB05 HEL C218(2.81)  LDD3185  [2]
 LDCM0131  RA190 MM1.R C218(3.28)  LDD0304  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NADH-cytochrome b5 reductase 3 (CYB5R3) Flavoprotein pyridine nucleotide cytochrome reductase family P00387
Heme oxygenase 2 (HMOX2) Heme oxygenase family P30519
Ubiquitin-conjugating enzyme E2 J1 (UBE2J1) Ubiquitin-conjugating enzyme family Q9Y385
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Glycophorin-A (GYPA) Glycophorin A family P02724
Insulin-induced gene 2 protein (INSIG2) INSIG family Q9Y5U4
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3) Immunoglobulin superfamily Q8N743
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein dispatched homolog 1 (DISP1) Dispatched family Q96F81
Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1) LDLR family Q5T700
Protein reprimo (RPRM) Reprimo family Q9NS64
Receptor-transporting protein 2 (RTP2) TMEM7 family Q5QGT7
Large ribosomal subunit protein uL18m (MRPL18) Universal ribosomal protein uL18 family Q9H0U6

References

1 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578