Details of the Target

General Information of Target

Target ID LDTP05738
Target Name Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3)
Gene Name MKRN3
Gene ID 7681
Synonyms
D15S9; RNF63; ZNF127; Probable E3 ubiquitin-protein ligase makorin-3; EC 2.3.2.27; RING finger protein 63; RING-type E3 ubiquitin transferase makorin-3; Zinc finger protein 127
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEEPAAPSEAHEAAGAQAGAEAAREGVSGPDLPVCEPSGESAAPDSALPHAARGWAPFPV
APVPAHLRRGGLRPAPASGGGAWPSPLPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQSSETERKQMAVGSG
LRFCYYASRGVCFRGESCMYLHGDICDMCGLQTLHPMDAAQREEHMRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIRCIRRWRSARQFENRIVKS
CPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLS
LRDELPFSEDQWDLLHYELEEYFNLIL
Target Bioclass
Enzyme
Function E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins.
Uniprot ID
Q13064
Ensemble ID
ENST00000314520.6
HGNC ID
HGNC:7114

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C35(10.00)  LDD2157  [1]
DBIA
 Probe Info  		C109(1.76)  LDD3338  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0214  AC1 HEK-293T C289(1.08)  LDD1507  [3]
 LDCM0237  AC12 HEK-293T C289(1.06)  LDD1510  [3]
 LDCM0276  AC17 HEK-293T C289(1.01)  LDD1515  [3]
 LDCM0280  AC20 HEK-293T C289(0.96)  LDD1519  [3]
 LDCM0285  AC25 HEK-293T C289(0.83)  LDD1524  [3]
 LDCM0288  AC28 HEK-293T C289(1.10)  LDD1527  [3]
 LDCM0294  AC33 HEK-293T C289(0.99)  LDD1533  [3]
 LDCM0297  AC36 HEK-293T C289(1.01)  LDD1536  [3]
 LDCM0301  AC4 HEK-293T C289(1.07)  LDD1540  [3]
 LDCM0303  AC41 HEK-293T C289(1.12)  LDD1542  [3]
 LDCM0306  AC44 HEK-293T C289(1.09)  LDD1545  [3]
 LDCM0311  AC49 HEK-293T C289(1.04)  LDD1550  [3]
 LDCM0315  AC52 HEK-293T C289(1.00)  LDD1554  [3]
 LDCM0320  AC57 HEK-293T C289(1.05)  LDD1559  [3]
 LDCM0324  AC60 HEK-293T C289(1.04)  LDD1563  [3]
 LDCM0356  AKOS034007680 HEK-293T C289(1.03)  LDD1570  [3]
 LDCM0404  CL17 HEK-293T C289(0.98)  LDD1608  [3]
 LDCM0408  CL20 HEK-293T C289(1.05)  LDD1612  [3]
 LDCM0417  CL29 HEK-293T C289(0.95)  LDD1621  [3]
 LDCM0421  CL32 HEK-293T C289(1.10)  LDD1625  [3]
 LDCM0431  CL41 HEK-293T C289(0.97)  LDD1635  [3]
 LDCM0434  CL44 HEK-293T C289(1.01)  LDD1638  [3]
 LDCM0440  CL5 HEK-293T C289(1.12)  LDD1644  [3]
 LDCM0444  CL53 HEK-293T C289(1.05)  LDD1647  [3]
 LDCM0447  CL56 HEK-293T C289(1.09)  LDD1650  [3]
 LDCM0457  CL65 HEK-293T C289(1.07)  LDD1660  [3]
 LDCM0460  CL68 HEK-293T C289(1.15)  LDD1663  [3]
 LDCM0470  CL77 HEK-293T C289(0.84)  LDD1673  [3]
 LDCM0473  CL8 HEK-293T C289(0.94)  LDD1676  [3]
 LDCM0474  CL80 HEK-293T C289(1.04)  LDD1677  [3]
 LDCM0483  CL89 HEK-293T C289(1.02)  LDD1686  [3]
 LDCM0487  CL92 HEK-293T C289(1.02)  LDD1690  [3]
 LDCM0022  KB02 697 C109(1.30)  LDD2245  [2]
 LDCM0023  KB03 697 C109(1.63)  LDD2662  [2]
 LDCM0024  KB05 MV4-11 C109(1.76)  LDD3338  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 24 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT) ANT/ATPSC lysine N-methyltransferase family Q9BQD7
DNA-directed RNA polymerases I and III subunit RPAC1 (POLR1C) Archaeal Rpo3/eukaryotic RPB3 RNA polymerase subunit family O15160
Histone-lysine N-methyltransferase SMYD3 (SMYD3) Histone-lysine methyltransferase family Q9H7B4
Phenylalanine--tRNA ligase, mitochondrial (FARS2) Class-II aminoacyl-tRNA synthetase family O95363
NADH dehydrogenase 1 beta subcomplex subunit 7 (NDUFB7) Complex I NDUFB7 subunit family P17568
DNA-(apurinic or apyrimidinic site) endonuclease 2 (APEX2) DNA repair enzymes AP/ExoA family Q9UBZ4
DNA excision repair protein ERCC-1 (ERCC1) ERCC1/RAD10/SWI10 family P07992
Beta-hexosaminidase subunit beta (HEXB) Glycosyl hydrolase 20 family P07686
Inactive glycosyltransferase 25 family member 3 (CERCAM) Glycosyltransferase 25 family Q5T4B2
Nucleoside diphosphate kinase, mitochondrial (NME4) NDK family O00746
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Thioredoxin domain-containing protein 11 (TXNDC11) Protein disulfide isomerase family Q6PKC3
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Protein-tyrosine kinase 6 (PTK6) Tyr protein kinase family Q13882
Dexamethasone-induced Ras-related protein 1 (RASD1) RasD family Q9Y272
GTP-binding protein GEM (GEM) RGK family P55040
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Ubiquitin-conjugating enzyme E2 D1 (UBE2D1) Ubiquitin-conjugating enzyme family P51668
Ubiquitin-conjugating enzyme E2 K (UBE2K) Ubiquitin-conjugating enzyme family P61086
Ataxin-3 (ATXN3) . P54252
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-like protein 11 (BCL2L11) Bcl-2 family O43521
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Peroxisome assembly protein 26 (PEX26) Peroxin-26 family Q7Z412
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Transcription factor AP-2-alpha (TFAP2A) AP-2 family P05549
Basic leucine zipper transcriptional factor ATF-like 2 (BATF2) BZIP family Q8N1L9
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Krueppel-like factor 1 (KLF1) Krueppel C2H2-type zinc-finger protein family Q13351
Zinc finger imprinted 2 (ZIM2) Krueppel C2H2-type zinc-finger protein family Q9NZV7
Zinc finger protein 414 (ZNF414) Krueppel C2H2-type zinc-finger protein family Q96IQ9
Zinc finger protein 587 (ZNF587) Krueppel C2H2-type zinc-finger protein family Q96SQ5
Zinc finger protein 688 (ZNF688) Krueppel C2H2-type zinc-finger protein family P0C7X2
Zinc finger protein 835 (ZNF835) Krueppel C2H2-type zinc-finger protein family Q9Y2P0
Zinc finger and BTB domain-containing protein 42 (ZBTB42) Krueppel C2H2-type zinc-finger protein family B2RXF5
AT-rich interactive domain-containing protein 5A (ARID5A) . Q03989
Golgin-45 (BLZF1) . Q9H2G9
Homeobox protein MOX-1 (MEOX1) . P50221
Transcriptional adapter 2-alpha (TADA2A) . O75478
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-2C adrenergic receptor (ADRA2C) G-protein coupled receptor 1 family P18825
Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R) G-protein coupled receptor 2 family Q03431
Other
Click To Hide/Show 76 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein sigma (SFN) 14-3-3 family P31947
Atos homolog protein B (ATOSB) ATOS family Q7L5A3
Small ribosomal subunit protein bS6m (MRPS6) Bacterial ribosomal protein bS6 family P82932
Splicing factor 1 (SF1) BBP/SF1 family Q15637
Protein BEX2 (BEX2) BEX family Q9BXY8
BPI fold-containing family A member 1 (BPIFA1) Plunc family Q9NP55
EKC/KEOPS complex subunit LAGE3 (LAGE3) CTAG/PCC1 family Q14657
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (ECSIT) ECSIT family Q9BQ95
EF-hand calcium-binding domain-containing protein 4B (CRACR2A) EFCAB4 family Q9BSW2
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Protein FAM124B (FAM124B) FAM124 family Q9H5Z6
EGF-containing fibulin-like extracellular matrix protein 1 (EFEMP1) Fibulin family Q12805
Golgin subfamily A member 6A (GOLGA6A) GOLGA6 family Q9NYA3
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin-associated protein 19-2 (KRTAP19-2) KRTAP type 19 family Q3LHN2
Keratin-associated protein 19-6 (KRTAP19-6) KRTAP type 19 family Q3LI70
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Keratin-associated protein 6-2 (KRTAP6-2) KRTAP type 6 family Q3LI66
Keratin-associated protein 7-1 (KRTAP7-1) KRTAP type 7 family Q8IUC3
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Protein Mdm4 (MDM4) MDM2/MDM4 family O15151
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Myozenin-2 (MYOZ2) Myozenin family Q9NPC6
Ciliary microtubule associated protein 1B (CIMAP1B) ODF3 family A8MYP8
Large ribosomal subunit protein mL38 (MRPL38) Phosphatidylethanolamine-binding protein family Q96DV4
Pro-opiomelanocortin (POMC) POMC family P01189
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
R-spondin-4 (RSPO4) R-spondin family Q2I0M5
RIB43A-like with coiled-coils protein 1 (RIBC1) RIB43A family Q8N443
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
SOSS complex subunit B2 (NABP1) SOSS-B family Q96AH0
Stathmin-3 (STMN3) Stathmin family Q9NZ72
CST complex subunit STN1 (STN1) STN1 family Q9H668
Protein TASOR 2 (TASOR2) TASOR family Q5VWN6
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
T-cell leukemia/lymphoma protein 1B (TCL1B) TCL1 family O95988
Tetraspanin-4 (TSPAN4) Tetraspanin (TM4SF) family O14817
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
U1 small nuclear ribonucleoprotein C (SNRPC) U1 small nuclear ribonucleoprotein C family P09234
Antileukoproteinase (SLPI) . P03973
Arginine vasopressin-induced protein 1 (AVPI1) . Q5T686
Armadillo repeat-containing protein 5 (ARMC5) . Q96C12
Cell division cycle-associated protein 4 (CDCA4) . Q9BXL8
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 185 (CCDC185) . Q8N715
Enkurin domain-containing protein 1 (ENKD1) . Q9H0I2
Extracellular matrix protein 1 (ECM1) . Q16610
Heat shock factor 2-binding protein (HSF2BP) . O75031
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
INO80 complex subunit B (INO80B) . Q9C086
Kelch-like protein 38 (KLHL38) . Q2WGJ6
Keratin-associated protein 21-2 (KRTAP21-2) . Q3LI59
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Melanoma-associated antigen D1 (MAGED1) . Q9Y5V3
Mitochondrial coiled-coil domain protein 1 (MCCD1) . P59942
MORN repeat-containing protein 3 (MORN3) . Q6PF18
Outer dynein arm-docking complex subunit 4 (ODAD4) . Q96NG3
Proline-rich protein 35 (PRR35) . P0CG20
Ras/Rap GTPase-activating protein SynGAP (SYNGAP1) . Q96PV0
Receptor-transporting protein 5 (RTP5) . Q14D33
RNA-binding protein 41 (RBM41) . Q96IZ5
RNA-binding protein with multiple splicing 2 (RBPMS2) . Q6ZRY4
Saitohin (STH) . Q8IWL8
Spermatogenesis-associated protein 8 (SPATA8) . Q6RVD6
TAR DNA-binding protein 43 (TARDBP) . Q13148
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00
Ubiquinol-cytochrome c reductase complex assembly factor 2 (UQCC2) . Q9BRT2
Vinexin (SORBS3) . O60504
VPS9 domain-containing protein 1 (VPS9D1) . Q9Y2B5

References

1 From chemoproteomic-detected amino acids to genomic coordinates: insights into precise multi-omic data integration. Mol Syst Biol. 2021 Feb;17(2):e9840. doi: 10.15252/msb.20209840.
Mass spectrometry data entry: PXD022151
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402