Details of the Target

General Information of Target

Target ID LDTP05361
Target Name Paired box protein Pax-5 (PAX5)
Gene Name PAX5
Gene ID 5079
Synonyms
Paired box protein Pax-5; B-cell-specific transcription factor; BSAP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLA
ERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYS
ISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRV
FERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
IVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRF
PNPGLLGSPYYYSAAARGAAPPAAATAYDRH
Target Type
Literature-reported
Target Bioclass
Transcription factor
Subcellular location
Nucleus
Function
Transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage. Fulfills a dual role by repressing B-lineage inappropriate genes and simultaneously activating B-lineage-specific genes. In turn, regulates cell adhesion and migration, induces V(H)-to-D(H)J(H) recombination, facilitates pre-B-cell receptor signaling and promotes development to the mature B-cell stage. Repression of the cohesin-release factor WAPL causes global changes of the chromosomal architecture in pro-B cells to facilitate the generation of a diverse antibody repertoire.; (Microbial infection) Plays an essential role in the maintenance of Epstein-Barr virus genome copy number within the host cell by promoting EBNA1/oriP-dependent binding and transcription. Participates also in the inhibition of lytic EBV reactivation by modulating viral BZLF1 activity.
TTD ID
T29818
Uniprot ID
Q02548
DrugMap ID
TTA4REJ
Ensemble ID
ENST00000358127.9
HGNC ID
HGNC:8619

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CCK81 Insertion: p.D125VfsTer35 .
COLO792 SNV: p.G76E .
DU145 SNV: p.R197H .
HCT15 Insertion: p.A322RfsTer19 .
HEC1 SNV: p.A375V .
HS936T SNV: p.R11W .
Ishikawa (Heraklio) 02 ER Deletion: p.A322LfsTer11 .
MKN1 SNV: p.A322D .
NCIH1155 SNV: p.R197H .
OVCAR5 SNV: p.H212Q .
PC9 SNV: p.P320R .
RL952 SNV: p.S133N .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		C52(2.83)  LDD2229  [1]
DBIA
 Probe Info  		C52(4.68)  LDD3339  [2]
IA-alkyne
 Probe Info  		C64(2.47); C52(3.42); C124(0.78)  LDD2182  [3]
Phosphinate-6
 Probe Info  		C64(0.00); C52(0.00)  LDD0018  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C64(1.83); C52(1.62)  LDD2187  [3]
 LDCM0572  Fragment10 Ramos C64(3.77); C52(1.65)  LDD2189  [3]
 LDCM0573  Fragment11 Ramos C64(0.94); C52(0.74)  LDD2190  [3]
 LDCM0574  Fragment12 Ramos C64(1.20); C52(1.12)  LDD2191  [3]
 LDCM0575  Fragment13 Ramos C64(0.97); C52(0.86)  LDD2192  [3]
 LDCM0576  Fragment14 Ramos C64(0.97); C52(0.90); C124(0.81)  LDD2193  [3]
 LDCM0579  Fragment20 Ramos C64(2.74); C52(1.72)  LDD2194  [3]
 LDCM0580  Fragment21 Ramos C64(1.17); C52(0.79)  LDD2195  [3]
 LDCM0582  Fragment23 Ramos C64(0.90); C52(0.71)  LDD2196  [3]
 LDCM0578  Fragment27 Ramos C64(1.02); C52(0.99)  LDD2197  [3]
 LDCM0586  Fragment28 Ramos C64(0.41); C52(0.67)  LDD2198  [3]
 LDCM0588  Fragment30 Ramos C64(1.34); C52(0.99)  LDD2199  [3]
 LDCM0589  Fragment31 Ramos C64(0.97); C52(0.72)  LDD2200  [3]
 LDCM0590  Fragment32 Ramos C64(2.06); C52(1.90)  LDD2201  [3]
 LDCM0468  Fragment33 Ramos C64(1.50); C52(1.29)  LDD2202  [3]
 LDCM0596  Fragment38 Ramos C64(1.00); C52(1.10)  LDD2203  [3]
 LDCM0566  Fragment4 Ramos C64(0.99); C52(1.22); C124(0.88)  LDD2184  [3]
 LDCM0610  Fragment52 Ramos C64(1.30); C52(0.97)  LDD2204  [3]
 LDCM0614  Fragment56 Ramos C64(1.54); C52(1.10)  LDD2205  [3]
 LDCM0569  Fragment7 Ramos C64(2.43); C52(1.85); C124(0.89)  LDD2186  [3]
 LDCM0571  Fragment9 Ramos C64(2.44); C52(1.60)  LDD2188  [3]
 LDCM0022  KB02 Ramos C64(2.47); C52(3.42); C124(0.78)  LDD2182  [3]
 LDCM0023  KB03 Ramos C64(1.30); C52(1.21); C124(0.86)  LDD2183  [3]
 LDCM0024  KB05 NALM-6 C52(4.68)  LDD3339  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable E3 ubiquitin-protein ligase DTX2 (DTX2) Deltex family Q86UW9
Endonuclease 8-like 2 (NEIL2) FPG family Q969S2
Cyclin-dependent kinase 3 (CDK3) CMGC Ser/Thr protein kinase family Q00526
Mitogen-activated protein kinase 9 (MAPK9) CMGC Ser/Thr protein kinase family P45984
Serine/threonine-protein kinase tousled-like 2 (TLK2) Ser/Thr protein kinase family Q86UE8
Casein kinase II subunit alpha (CSNK2A1) Ser/Thr protein kinase family P68400
Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase (NGLY1) PNGase family Q96IV0
SUMO-activating enzyme subunit 1 (SAE1) Ubiquitin-activating E1 family Q9UBE0
Acetyl-coenzyme A thioesterase (ACOT12) . Q8WYK0
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
SEC14-like protein 4 (SEC14L4) . Q9UDX3
SH3 and cysteine-rich domain-containing protein (STAC) . Q99469
Uncharacterized protein CXorf38 (CXorf38) . Q8TB03
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Grainyhead-like protein 2 homolog (GRHL2) Grh/CP2 family Q6ISB3
High mobility group protein B3 (HMGB3) HMGB family O15347
Homeobox-containing protein 1 (HMBOX1) . Q6NT76
Other
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclin-dependent kinases regulatory subunit 1 (CKS1B) CKS family P61024
Cyclin-C (CCNC) Cyclin family P24863
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 (GNG13) G protein gamma family Q9P2W3
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
UBX domain-containing protein 2B (UBXN2B) NSFL1C family Q14CS0
Oxidative stress-induced growth inhibitor 1 (OSGIN1) OKL38 family Q9UJX0
Paraneoplastic antigen-like protein 5 (PNMA5) PNMA family Q96PV4
DNA repair protein RAD52 homolog (RAD52) RAD52 family P43351
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Calcium and integrin-binding family member 3 (CIB3) . Q96Q77
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Kelch-like protein 38 (KLHL38) . Q2WGJ6
Low density lipoprotein receptor adapter protein 1 (LDLRAP1) . Q5SW96
UBX domain-containing protein 7 (UBXN7) . O94888

References

1 A quantitative thiol reactivity profiling platform to analyze redox and electrophile reactive cysteine proteomes. Nat Protoc. 2020 Sep;15(9):2891-2919. doi: 10.1038/s41596-020-0352-2. Epub 2020 Jul 20.
Mass spectrometry data entry: PXD016048
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
4 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004