Details of the Target
General Information of Target
| Target ID | LDTP05358 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA-binding protein inhibitor ID-3 (ID3) | |||||
| Gene Name | ID3 | |||||
| Gene ID | 3399 | |||||
| Synonyms |
1R21; BHLHB25; HEIR1; DNA-binding protein inhibitor ID-3; Class B basic helix-loop-helix protein 25; bHLHb25; Helix-loop-helix protein HEIR-1; ID-like protein inhibitor HLH 1R21; Inhibitor of DNA binding 3; Inhibitor of differentiation 3
|
|||||
| 3D Structure | ||||||
| Sequence |
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Involved in myogenesis by inhibiting skeletal muscle and cardiac myocyte differentiation and promoting muscle precursor cells proliferation. Inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C47(2.48) | LDD2184 | [1] | |
|
TFBX Probe Info |
 |
N.A. | LDD0027 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C47(1.00) | LDD2187 | [1] |
| LDCM0572 | Fragment10 | Ramos | C47(1.16) | LDD2189 | [1] |
| LDCM0573 | Fragment11 | Ramos | C47(0.67) | LDD2190 | [1] |
| LDCM0574 | Fragment12 | Ramos | C47(2.50) | LDD2191 | [1] |
| LDCM0575 | Fragment13 | Ramos | C47(0.92) | LDD2192 | [1] |
| LDCM0576 | Fragment14 | Ramos | C47(0.53) | LDD2193 | [1] |
| LDCM0580 | Fragment21 | Ramos | C47(0.88) | LDD2195 | [1] |
| LDCM0582 | Fragment23 | Ramos | C47(1.37) | LDD2196 | [1] |
| LDCM0578 | Fragment27 | Ramos | C47(1.11) | LDD2197 | [1] |
| LDCM0586 | Fragment28 | Ramos | C47(0.72) | LDD2198 | [1] |
| LDCM0588 | Fragment30 | Ramos | C47(1.01) | LDD2199 | [1] |
| LDCM0589 | Fragment31 | Ramos | C47(1.14) | LDD2200 | [1] |
| LDCM0590 | Fragment32 | Ramos | C47(1.12) | LDD2201 | [1] |
| LDCM0468 | Fragment33 | Ramos | C47(0.90) | LDD2202 | [1] |
| LDCM0596 | Fragment38 | Ramos | C47(0.66) | LDD2203 | [1] |
| LDCM0566 | Fragment4 | Ramos | C47(2.48) | LDD2184 | [1] |
| LDCM0610 | Fragment52 | Ramos | C47(0.96) | LDD2204 | [1] |
| LDCM0614 | Fragment56 | Ramos | C47(1.06) | LDD2205 | [1] |
| LDCM0569 | Fragment7 | Ramos | C47(0.97) | LDD2186 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Histone acetyltransferase KAT5 (KAT5) | MYST (SAS/MOZ) family | Q92993 | |||
| Ras-related protein Rab-7a (RAB7A) | Rab family | P51149 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Syntenin-1 (SDCBP) | . | O00560 | |||
Transcription factor
Other
References