Details of the Target
General Information of Target
| Target ID | LDTP05349 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA-binding protein inhibitor ID-2 (ID2) |
|
||||
| Gene Name | ID2 | |||||
| Gene ID | 3398 | |||||
| Synonyms |
BHLHB26; DNA-binding protein inhibitor ID-2; Class B basic helix-loop-helix protein 26; bHLHb26; Inhibitor of DNA binding 2; Inhibitor of differentiation 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF PSELMSNDSKALCG |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer. Restricts the CLOCK and BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C42(0.26) | LDD2187 | [1] | |
|
IPM Probe Info |
 |
N.A. | LDD2156 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C42(0.26) | LDD2187 | [1] |
| LDCM0572 | Fragment10 | Ramos | C42(1.02) | LDD2189 | [1] |
| LDCM0573 | Fragment11 | Ramos | C42(3.54) | LDD2190 | [1] |
| LDCM0575 | Fragment13 | Ramos | C42(1.14) | LDD2192 | [1] |
| LDCM0580 | Fragment21 | Ramos | C42(1.24) | LDD2195 | [1] |
| LDCM0582 | Fragment23 | Ramos | C42(0.35) | LDD2196 | [1] |
| LDCM0588 | Fragment30 | Ramos | C42(0.70) | LDD2199 | [1] |
| LDCM0468 | Fragment33 | Ramos | C42(0.43) | LDD2202 | [1] |
| LDCM0596 | Fragment38 | Ramos | C42(3.72) | LDD2203 | [1] |
| LDCM0614 | Fragment56 | Ramos | C42(0.94) | LDD2205 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| 14-3-3 protein gamma (YWHAG) | 14-3-3 family | P61981 | |||
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Polycystin-2 (PKD2) | Polycystin family | Q13563 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Achaete-scute homolog 4 (ASCL4) | . | Q6XD76 | |||
| Mesogenin-1 (MSGN1) | . | A6NI15 | |||
| Transcription factor 12 (TCF12) | . | Q99081 | |||
| Transcription factor 4 (TCF4) | . | P15884 | |||
Other
References