General Information of Target

Target ID LDTP05302
Target Name Interferon-induced transmembrane protein 3 (IFITM3)
Gene Name IFITM3
Gene ID 10410
Synonyms
Interferon-induced transmembrane protein 3; Dispanin subfamily A member 2b; DSPA2b; Interferon-inducible protein 1-8U
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVW
SLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIL
LIVIPVLIFQAYG
Target Bioclass
Transporter and channel
Family
CD225/Dispanin family
Subcellular location
Cell membrane
Function
IFN-induced antiviral protein which disrupts intracellular cholesterol homeostasis. Inhibits the entry of viruses to the host cell cytoplasm by preventing viral fusion with cholesterol depleted endosomes. May inactivate new enveloped viruses which buds out of the infected cell, by letting them go out with a cholesterol depleted membrane. Active against multiple viruses, including influenza A virus, SARS coronaviruses (SARS-CoV and SARS-CoV-2), Marburg virus (MARV), Ebola virus (EBOV), Dengue virus (DNV), West Nile virus (WNV), human immunodeficiency virus type 1 (HIV-1), hepatitis C virus (HCV) and vesicular stomatitis virus (VSV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry, SARS-CoV and SARS-CoV-2 S protein-mediated viral entry and VSV G protein-mediated viral entry. Plays a critical role in the structural stability and function of vacuolar ATPase (v-ATPase). Establishes physical contact with the v-ATPase of endosomes which is critical for proper clathrin localization and is also required for the function of the v-ATPase to lower the pH in phagocytic endosomes thus establishing an antiviral state. In hepatocytes, IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation. IFITM2 and IFITM3 display anti-HCV activity that may complement the anti-HCV activity of IFITM1 by inhibiting the late stages of HCV entry, possibly in a coordinated manner by trapping the virion in the endosomal pathway and targeting it for degradation at the lysosome. Exerts opposing activities on SARS-CoV-2, including amphipathicity-dependent restriction of virus at endosomes and amphipathicity-independent enhancement of infection at the plasma membrane.
Uniprot ID
Q01628
Ensemble ID
ENST00000399808.5
HGNC ID
HGNC:5414

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
D5yne
 Probe Info 
1.65  LDD0055  [1]
Acrolein
 Probe Info 
H47(0.00); H36(0.00)  LDD0221  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa H36(0.00); H47(0.00)  LDD0222  [2]
 LDCM0095  DC-LC3IN-D5 HeLa 1.65  LDD0055  [1]
 LDCM0107  IAA HeLa H47(0.00); H36(0.00)  LDD0221  [2]
 LDCM0109  NEM HeLa H36(0.00); H47(0.00)  LDD0223  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Phosphatidylserine lipase ABHD16A (ABHD16A) ABHD16 family O95870
Very long chain fatty acid elongase 2 (ELOVL2) ELO family Q9NXB9
Sphingosine-1-phosphate lyase 1 (SGPL1) Group II decarboxylase family O95470
Nicotinamide phosphoribosyltransferase (NAMPT) NAPRTase family P43490
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
Peptidyl-prolyl cis-trans isomerase FKBP7 (FKBP7) . Q9Y680
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hepatic sodium/bile acid cotransporter (SLC10A1) Bile acid:sodium symporter (BASS) family Q14973
Ileal sodium/bile acid cotransporter (SLC10A2) Bile acid:sodium symporter (BASS) family Q12908
Monocarboxylate transporter 2 (SLC16A7) Monocarboxylate porter (TC 2.A.1.13) family O60669
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Membrane-spanning 4-domains subfamily A member 3 (MS4A3) MS4A family Q96HJ5
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor family C group 5 member D (GPRC5D) G-protein coupled receptor 3 family Q9NZD1
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) Immunoglobulin superfamily P43628
Other
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Membrane protein BRI3 (BRI3) BRI3 family O95415
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM210B, mitochondrial (FAM210B) FAM210 family Q96KR6
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Ly6/PLAUR domain-containing protein 5 (LYPD5) . Q6UWN5

References

1 Inhibition of Autophagy by a Small Molecule through Covalent Modification of the LC3 Protein. Angew Chem Int Ed Engl. 2021 Dec 6;60(50):26105-26114. doi: 10.1002/anie.202109464. Epub 2021 Nov 5.
Mass spectrometry data entry: PXD026874
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.