Details of the Target
General Information of Target
Target ID | LDTP05242 | |||||
---|---|---|---|---|---|---|
Target Name | Cyclin-dependent kinase 3 (CDK3) | |||||
Gene Name | CDK3 | |||||
Gene ID | 1018 | |||||
Synonyms |
CDKN3; Cyclin-dependent kinase 3; EC 2.7.11.22; Cell division protein kinase 3 |
|||||
3D Structure | ||||||
Sequence |
MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKH
PNIVRLLDVVHNERKLYLVFEFLSQDLKKYMDSTPGSELPLHLIKSYLFQLLQGVSFCHS HRVIHRDLKPQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFY TTAVDIWSIGCIFAEMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSF PKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVL QRFRH |
|||||
Target Type |
Clinical trial
|
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
|
|||||
Function |
Serine/threonine-protein kinase that plays a critical role in the control of the eukaryotic cell cycle; involved in G0-G1 and G1-S cell cycle transitions. Interacts with CCNC/cyclin-C during interphase. Phosphorylates histone H1, ATF1, RB1 and CABLES1. ATF1 phosphorylation triggers ATF1 transactivation and transcriptional activities, and promotes cell proliferation and transformation. CDK3/cyclin-C mediated RB1 phosphorylation is required for G0-G1 transition. Promotes G1-S transition probably by contributing to the activation of E2F1, E2F2 and E2F3 in a RB1-independent manner.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
Sulforaphane-probe2 Probe Info |
![]() |
1.95 | LDD0160 | [1] | |
HHS-475 Probe Info |
![]() |
Y159(1.04); Y19(1.04) | LDD0264 | [2] | |
HHS-465 Probe Info |
![]() |
Y19(10.00) | LDD2237 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0116 | HHS-0101 | DM93 | Y159(1.04); Y19(1.04) | LDD0264 | [2] |
LDCM0117 | HHS-0201 | DM93 | Y19(0.57); Y159(0.87) | LDD0265 | [2] |
LDCM0118 | HHS-0301 | DM93 | Y159(0.63); Y19(0.64) | LDD0266 | [2] |
LDCM0119 | HHS-0401 | DM93 | Y159(0.66); Y19(0.78) | LDD0267 | [2] |
LDCM0120 | HHS-0701 | DM93 | Y159(0.90); Y19(1.07) | LDD0268 | [2] |
LDCM0003 | Sulforaphane | MDA-MB-231 | 1.95 | LDD0160 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Heat shock protein HSP 90-beta (HSP90AB1) | Heat shock protein 90 family | P08238 |
Transcription factor
GPCR
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Olfactory receptor 2G6 (OR2G6) | G-protein coupled receptor 1 family | Q5TZ20 |
Other
The Drug(s) Related To This Target
Phase 1
Drug Name | Drug Type | External ID | |||
---|---|---|---|---|---|
Rgb-286638 | Small molecular drug | D03DKV |
Patented
References