General Information of Target

Target ID LDTP05158
Target Name Interferon-induced 35 kDa protein (IFI35)
Gene Name IFI35
Gene ID 3430
Synonyms
IFP35; Interferon-induced 35 kDa protein; IFP 35; Ifi-35
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDP
EVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPM
VTTIQMSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVM
LGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPD
ILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Target Bioclass
Other
Family
NMI family
Subcellular location
Cytoplasm
Function
Acts as a signaling pathway regulator involved in innate immune system response. In response to interferon IFN-alpha, associates in a complex with signaling pathway regulator NMI to regulate immune response; the complex formation prevents proteasome-mediated degradation of IFI35 and correlates with IFI35 dephosphorylation. In complex with NMI, inhibits virus-triggered type I interferon/IFN-beta production. In complex with NMI, negatively regulates nuclear factor NF-kappa-B signaling by inhibiting the nuclear translocation, activation and transcription of the NF-kappa-B subunit p65/RELA, resulting in the inhibition of endothelial cell proliferation, migration and re-endothelialization of injured arteries. Beside its role as an intracellular signaling pathway regulator, also functions extracellularly as damage-associated molecular patterns (DAMPs) to promote inflammation when actively released by macrophage to the extracellular space during cell injury and pathogen invasion. Macrophage-secreted IFI35 activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 activation, thereby inducing NF-kappa-B translocation from the cytoplasm into the nucleus which promotes the release of pro-inflammatory cytokines.
Uniprot ID
P80217
Ensemble ID
ENST00000415816.7
HGNC ID
HGNC:5399

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info 
C107(1.00); C195(2.34)  LDD3310  [1]
5E-2FA
 Probe Info 
N.A.  LDD2235  [2]
m-APA
 Probe Info 
N.A.  LDD2231  [2]
4-Iodoacetamidophenylacetylene
 Probe Info 
C74(0.00); C193(0.00); C107(0.00)  LDD0038  [3]
IA-alkyne
 Probe Info 
C107(0.00); C74(0.00); C193(0.00)  LDD0036  [3]
Lodoacetamide azide
 Probe Info 
C107(0.00); C74(0.00); C193(0.00)  LDD0037  [3]
Acrolein
 Probe Info 
N.A.  LDD0217  [4]
NAIA_5
 Probe Info 
N.A.  LDD2223  [5]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
VE-P
 Probe Info 
N.A.  LDD0396  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [4]
 LDCM0625  F8 Ramos C107(1.63)  LDD2187  [7]
 LDCM0573  Fragment11 Ramos C107(0.37)  LDD2190  [7]
 LDCM0576  Fragment14 Ramos C107(0.69)  LDD2193  [7]
 LDCM0566  Fragment4 Ramos C107(0.88)  LDD2184  [7]
 LDCM0569  Fragment7 Ramos C107(0.66)  LDD2186  [7]
 LDCM0107  IAA HeLa N.A.  LDD0221  [4]
 LDCM0022  KB02 Ramos C107(0.72)  LDD2182  [7]
 LDCM0023  KB03 Ramos C107(0.84)  LDD2183  [7]
 LDCM0024  KB05 COLO792 C107(1.00); C195(2.34)  LDD3310  [1]
 LDCM0109  NEM HeLa N.A.  LDD0224  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
S-adenosylmethionine synthase isoform type-2 (MAT2A) AdoMet synthase family P31153
Superoxide dismutase [Cu-Zn] (SOD1) Cu-Zn superoxide dismutase family P00441
E3 SUMO-protein ligase PIAS4 (PIAS4) PIAS family Q8N2W9
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Alpha-synuclein (SNCA) Synuclein family P37840
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Other
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1 (ATXN1) ATXN1 family P54253
Axonemal dynein light intermediate polypeptide 1 (DNALI1) Inner dynein arm light chain family O14645
N-myc-interactor (NMI) NMI family Q13287
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
C-type lectin domain family 4 member G (CLEC4G) . Q6UXB4
Four and a half LIM domains protein 2 (FHL2) . Q14192
TAR DNA-binding protein 43 (TARDBP) . Q13148

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.
7 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578