Details of the Target
General Information of Target
| Target ID | LDTP05016 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein (FAU) | |||||
| Gene Name | FAU | |||||
| Gene ID | 2197 | |||||
| Synonyms |
Ubiquitin-like FUBI-ribosomal protein eS30 fusion protein; FAU ubiquitin like and ribosomal protein S30 fusion) [Cleaved into: Ubiquitin-like protein FUBI; Small ribosomal subunit protein eS30; 40S ribosomal protein S30)]
|
|||||
| 3D Structure | ||||||
| Sequence |
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVE
ALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV PTFGKKKGPNANS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Ubiquitin family; Eukaryotic ribosomal protein eS30 family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
[Ubiquitin-like protein FUBI]: May have pro-apoptotic activity.; [Small ribosomal subunit protein eS30]: Component of the 40S subunit of the ribosome. Contributes to the assembly and function of 40S ribosomal subunits.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
 |
4.19 | LDD0066 | [1] | |
|
ONAyne Probe Info |
 |
K1(2.41); K18(10.00); K51(2.55) | LDD0274 | [2] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0221 | [3] | |
|
AMP probe Probe Info |
 |
K125(0.00); K126(0.00) | LDD0200 | [4] | |
|
ATP probe Probe Info |
 |
K125(0.00); K126(0.00); K92(0.00); K127(0.00) | LDD0199 | [4] | |
|
ATP probe Probe Info |
 |
N.A. | LDD0035 | [5] | |
|
NHS Probe Info |
 |
N.A. | LDD0010 | [6] | |
|
STPyne Probe Info |
 |
N.A. | LDD0009 | [6] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References