Details of the Target
General Information of Target
| Target ID | LDTP04985 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thymosin beta-4 (TMSB4X) | |||||
| Gene Name | TMSB4X | |||||
| Gene ID | 7114 | |||||
| Synonyms |
TB4X; THYB4; TMSB4; Thymosin beta-4; T beta-4; Fx) [Cleaved into: Hemoregulatory peptide AcSDKP; Ac-Ser-Asp-Lys-Pro; N-acetyl-SDKP; AcSDKP; Seraspenide)] |
|||||
| 3D Structure | ||||||
| Sequence |
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
|
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Thymosin beta family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.; [Hemoregulatory peptide AcSDKP]: Potent inhibitor of bone marrow derived stem cell differentiation. Acts by inhibits the entry of hematopoietic pluripotent stem cells into the S-phase.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY-1 Probe Info |
![]() |
N.A. | LDD0246 | [1] | |
|
ATP probe Probe Info |
![]() |
K12(0.00); K32(0.00) | LDD0035 | [2] | |
|
AZ-9 Probe Info |
![]() |
N.A. | LDD0395 | [3] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Amyloid-beta precursor protein (APP) | APP family | P05067 | |||
Other
References



