Details of the Target
General Information of Target
| Target ID | LDTP04905 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane protein 258 (TMEM258) | |||||
| Gene Name | TMEM258 | |||||
| Gene ID | 746 | |||||
| Synonyms |
C11orf10; Transmembrane protein 258; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TMEM258; Oligosaccharyl transferase subunit TMEM258 |
|||||
| 3D Structure | ||||||
| Sequence |
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA
SLFMGFGVLFLLLWVGIYV |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
OST5 family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. Involved in ER homeostasis in the colonic epithelium.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
 |
6.51 | LDD0066 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Major facilitator superfamily domain-containing protein 6 (MFSD6) | MFSD6 family | Q6ZSS7 | |||
Other