Details of the Target
General Information of Target
Target ID | LDTP04795 | |||||
---|---|---|---|---|---|---|
Target Name | Ras-related protein Rab-38 (RAB38) | |||||
Gene Name | RAB38 | |||||
Gene ID | 23682 | |||||
Synonyms |
Ras-related protein Rab-38; Melanoma antigen NY-MEL-1 |
|||||
3D Structure | ||||||
Sequence |
MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVR
LQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPV SVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILAN ECDLMESIEPDVVKPHLTSTKVASCSGCAKS |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
Small GTPase superfamily, Rab family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Involved in peripheral melanosomal distribution of TYRP1 in melanocytes; the function, which probably is implicating vesicle-trafficking, includes cooperation with ANKRD27 and VAMP7. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays an important role in the control of melanin production and melanosome biogenesis. In concert with RAB32, regulates the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C147(2.13) | LDD3375 | [1] | |
AHL-Pu-1 Probe Info |
![]() |
C182(3.71) | LDD0170 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [3] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Junctophilin-3 (JPH3) | Junctophilin family | Q8WXH2 |
Other
References