Details of the Target
General Information of Target
| Target ID | LDTP04761 | |||||
|---|---|---|---|---|---|---|
| Target Name | Claudin-6 (CLDN6) | |||||
| Gene Name | CLDN6 | |||||
| Gene ID | 9074 | |||||
| Synonyms |
Claudin-6; Skullin |
|||||
| 3D Structure | ||||||
| Sequence |
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLT SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL LCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Claudin family
|
|||||
| Subcellular location |
Cell junction, tight junction
|
|||||
| Function | Plays a major role in tight junction-specific obliteration of the intercellular space.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells. | |||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
|
YN-4 Probe Info |
![]() |
100.00 | LDD0445 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Insulin-like growth factor-binding protein 5 (IGFBP5) | . | P24593 | |||


