Details of the Target
General Information of Target
Target ID | LDTP04733 | |||||
---|---|---|---|---|---|---|
Target Name | cAMP-regulated phosphoprotein 19 (ARPP19) | |||||
Gene Name | ARPP19 | |||||
Gene ID | 10776 | |||||
Synonyms |
cAMP-regulated phosphoprotein 19; ARPP-19 |
|||||
3D Structure | ||||||
Sequence |
MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYF
DSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG |
|||||
Target Bioclass |
Other
|
|||||
Family |
Endosulfine family
|
|||||
Subcellular location |
Cytoplasm
|
|||||
Function |
Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-62 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase. May indirectly enhance GAP-43 expression.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
C-Sul Probe Info |
![]() |
57.27 | LDD0066 | [1] | |
STPyne Probe Info |
![]() |
K109(7.49); K42(2.61) | LDD0277 | [2] | |
5E-2FA Probe Info |
![]() |
N.A. | LDD2235 | [3] | |
AMP probe Probe Info |
![]() |
N.A. | LDD0200 | [4] | |
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [4] | |
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [3] | |
SF Probe Info |
![]() |
Y65(0.00); Y59(0.00); Y36(0.00) | LDD0028 | [5] | |
HHS-465 Probe Info |
![]() |
K69(0.00); Y59(0.00); Y36(0.00); Y65(0.00) | LDD2240 | [6] |
The Interaction Atlas With This Target
References