Details of the Target
General Information of Target
| Target ID | LDTP04659 | |||||
|---|---|---|---|---|---|---|
| Target Name | Oxysterols receptor LXR-beta (NR1H2) | |||||
| Gene Name | NR1H2 | |||||
| Gene ID | 7376 | |||||
| Synonyms |
LXRB; NER; UNR; Oxysterols receptor LXR-beta; Liver X receptor beta; Nuclear receptor NER; Nuclear receptor subfamily 1 group H member 2; Ubiquitously-expressed nuclear receptor |
|||||
| 3D Structure | ||||||
| Sequence |
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE |
|||||
| Target Type |
Clinical trial
|
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Nuclear hormone receptor family, NR1 subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Nuclear receptor that exhibits a ligand-dependent transcriptional activation activity. Binds preferentially to double-stranded oligonucleotide direct repeats having the consensus half-site sequence 5'-AGGTCA-3' and 4-nt spacing (DR-4). Regulates cholesterol uptake through MYLIP-dependent ubiquitination of LDLR, VLDLR and LRP8; DLDLR and LRP8. Interplays functionally with RORA for the regulation of genes involved in liver metabolism. Induces LPCAT3-dependent phospholipid remodeling in endoplasmic reticulum (ER) membranes of hepatocytes, driving SREBF1 processing and lipogenesis. Via LPCAT3, triggers the incorporation of arachidonate into phosphatidylcholines of ER membranes, increasing membrane dynamics and enabling triacylglycerols transfer to nascent very low-density lipoprotein (VLDL) particles. Via LPCAT3 also counteracts lipid-induced ER stress response and inflammation, likely by modulating SRC kinase membrane compartmentalization and limiting the synthesis of lipid inflammatory mediators. Plays an anti-inflammatory role during the hepatic acute phase response by acting as a corepressor: inhibits the hepatic acute phase response by preventing dissociation of the N-Cor corepressor complex.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HEC1 | SNV: p.L225P; p.R266H | DBIA Probe Info | |||
| HEC1B | SNV: p.R266H | . | |||
| JURKAT | SNV: p.R428H | . | |||
| MEC1 | SNV: p.R416C | DBIA Probe Info | |||
| MFE319 | Insertion: p.Q174dup | DBIA Probe Info | |||
| OVK18 | SNV: p.L443P | . | |||
| REH | SNV: p.E322D | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C87(1.24) | LDD3310 | [1] | |
|
IPM Probe Info |
![]() |
C87(1.69) | LDD1701 | [2] | |
|
Photoprobe 2 Probe Info |
![]() |
S278(17.84) | LDD0307 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0226 | AC11 | HEK-293T | C87(0.81) | LDD1509 | [4] |
| LDCM0237 | AC12 | HEK-293T | C87(1.03) | LDD1510 | [4] |
| LDCM0278 | AC19 | HEK-293T | C87(1.20) | LDD1517 | [4] |
| LDCM0280 | AC20 | HEK-293T | C87(1.00) | LDD1519 | [4] |
| LDCM0287 | AC27 | HEK-293T | C87(0.92) | LDD1526 | [4] |
| LDCM0288 | AC28 | HEK-293T | C87(1.07) | LDD1527 | [4] |
| LDCM0290 | AC3 | HEK-293T | C87(0.88) | LDD1529 | [4] |
| LDCM0296 | AC35 | HEK-293T | C87(1.14) | LDD1535 | [4] |
| LDCM0297 | AC36 | HEK-293T | C87(1.10) | LDD1536 | [4] |
| LDCM0301 | AC4 | HEK-293T | C87(0.82) | LDD1540 | [4] |
| LDCM0305 | AC43 | HEK-293T | C87(0.95) | LDD1544 | [4] |
| LDCM0306 | AC44 | HEK-293T | C87(0.94) | LDD1545 | [4] |
| LDCM0314 | AC51 | HEK-293T | C87(0.77) | LDD1553 | [4] |
| LDCM0315 | AC52 | HEK-293T | C87(0.92) | LDD1554 | [4] |
| LDCM0322 | AC59 | HEK-293T | C87(0.81) | LDD1561 | [4] |
| LDCM0324 | AC60 | HEK-293T | C87(1.19) | LDD1563 | [4] |
| LDCM0406 | CL19 | HEK-293T | C87(1.07) | LDD1610 | [4] |
| LDCM0408 | CL20 | HEK-293T | C87(1.08) | LDD1612 | [4] |
| LDCM0420 | CL31 | HEK-293T | C87(1.05) | LDD1624 | [4] |
| LDCM0421 | CL32 | HEK-293T | C87(1.03) | LDD1625 | [4] |
| LDCM0433 | CL43 | HEK-293T | C87(0.93) | LDD1637 | [4] |
| LDCM0434 | CL44 | HEK-293T | C87(1.09) | LDD1638 | [4] |
| LDCM0446 | CL55 | HEK-293T | C87(1.07) | LDD1649 | [4] |
| LDCM0447 | CL56 | HEK-293T | C87(0.97) | LDD1650 | [4] |
| LDCM0459 | CL67 | HEK-293T | C87(0.88) | LDD1662 | [4] |
| LDCM0460 | CL68 | HEK-293T | C87(1.16) | LDD1663 | [4] |
| LDCM0462 | CL7 | HEK-293T | C87(1.11) | LDD1665 | [4] |
| LDCM0472 | CL79 | HEK-293T | C87(0.97) | LDD1675 | [4] |
| LDCM0473 | CL8 | HEK-293T | C87(0.93) | LDD1676 | [4] |
| LDCM0474 | CL80 | HEK-293T | C87(1.04) | LDD1677 | [4] |
| LDCM0486 | CL91 | HEK-293T | C87(1.00) | LDD1689 | [4] |
| LDCM0487 | CL92 | HEK-293T | C87(0.95) | LDD1690 | [4] |
| LDCM0022 | KB02 | 22RV1 | C87(1.30) | LDD2243 | [1] |
| LDCM0023 | KB03 | MDA-MB-231 | C87(1.69) | LDD1701 | [2] |
| LDCM0024 | KB05 | COLO792 | C87(1.24) | LDD3310 | [1] |
| LDCM0002 | Ward_cp1 | CCF-STTG1 | S278(17.84) | LDD0307 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| MyoD family inhibitor (MDFI) | MDFI family | Q99750 | |||
Transcription factor
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Coronin-2A (CORO2A) | WD repeat coronin family | Q92828 | |||
The Drug(s) Related To This Target
Approved
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Diacerein | Small molecular drug | DB11994 | |||
Phase 2
| Drug Name | Drug Type | External ID | |||
|---|---|---|---|---|---|
| Vtb-38543 | . | D01XMC | |||
Investigative
References



