Details of the Target
General Information of Target
Target ID | LDTP04564 | |||||
---|---|---|---|---|---|---|
Target Name | CCAAT/enhancer-binding protein gamma (CEBPG) | |||||
Gene Name | CEBPG | |||||
Gene ID | 1054 | |||||
Synonyms |
CCAAT/enhancer-binding protein gamma; C/EBP gamma |
|||||
3D Structure | ||||||
Sequence |
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR
NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD LFLEHAHNLADNVQSISTENTTADGDNAGQ |
|||||
Target Bioclass |
Transcription factor
|
|||||
Family |
BZIP family, C/EBP subfamily
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
YN-1 Probe Info |
![]() |
N.A. | LDD0446 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
Cytokine and receptor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Cyclic AMP-dependent transcription factor ATF-2 (ATF2) | BZIP family | P15336 |
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Prefoldin subunit 6 (PFDN6) | Prefoldin subunit beta family | O15212 |