Details of the Target
General Information of Target
| Target ID | LDTP04564 | |||||
|---|---|---|---|---|---|---|
| Target Name | CCAAT/enhancer-binding protein gamma (CEBPG) | |||||
| Gene Name | CEBPG | |||||
| Gene ID | 1054 | |||||
| Synonyms |
CCAAT/enhancer-binding protein gamma; C/EBP gamma |
|||||
| 3D Structure | ||||||
| Sequence |
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR
NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD LFLEHAHNLADNVQSISTENTTADGDNAGQ |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, C/EBP subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
N.A. | LDD0446 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
Cytokine and receptor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Cyclic AMP-dependent transcription factor ATF-2 (ATF2) | BZIP family | P15336 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Prefoldin subunit 6 (PFDN6) | Prefoldin subunit beta family | O15212 | |||

