Details of the Target
General Information of Target
| Target ID | LDTP04283 | |||||
|---|---|---|---|---|---|---|
| Target Name | CCAAT/enhancer-binding protein delta (CEBPD) | |||||
| Gene Name | CEBPD | |||||
| Gene ID | 1052 | |||||
| Synonyms |
CCAAT/enhancer-binding protein delta; C/EBP delta; Nuclear factor NF-IL6-beta; NF-IL6-beta |
|||||
| 3D Structure | ||||||
| Sequence |
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL TRDLAGLRQFFKQLPSPPFLPAAGTADCR |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
BZIP family, C/EBP subfamily
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AHL-Pu-1 Probe Info |
![]() |
C268(2.42) | LDD0171 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Importin-4 (IPO4) | Importin beta family | Q8TEX9 | |||
Transcription factor
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Fanconi anemia group D2 protein (FANCD2) | . | Q9BXW9 | |||

