Details of the Target

General Information of Target

Target ID LDTP04170
Target Name Transmembrane 4 L6 family member 4 (TM4SF4)
Gene Name TM4SF4
Gene ID 7104
Synonyms
ILTMP; Transmembrane 4 L6 family member 4; Intestine and liver tetraspan membrane protein; IL-TMP
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMI
FPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKC
LMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVN
GLLGTLCGDCQCCGCCGGDGPV
Target Bioclass
Transporter and channel
Family
L6 tetraspanin family
Subcellular location
Membrane
Function Regulates the adhesive and proliferative status of intestinal epithelial cells. Can mediate density-dependent cell proliferation.
Uniprot ID
P48230
Ensemble ID
ENST00000305354.5
HGNC ID
HGNC:11856

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		C2(0.00); C6(0.00)  LDD0241  [1]
BTD
 Probe Info  		C2(0.74)  LDD2107  [2]
4-Iodoacetamidophenylacetylene
 Probe Info  		C2(0.00); C6(0.00)  LDD0038  [3]
IA-alkyne
 Probe Info  		C2(0.00); C6(0.00)  LDD0036  [3]
Lodoacetamide azide
 Probe Info  		C2(0.00); C6(0.00)  LDD0037  [3]
TFBX
 Probe Info  		N.A.  LDD0148  [4]
W1
 Probe Info  		N.A.  LDD0236  [1]
NAIA_5
 Probe Info  		N.A.  LDD2223  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0213  Electrophilic fragment 2 MDA-MB-231 C2(1.23)  LDD1702  [2]
 LDCM0625  F8 Ramos 0.92  LDD2187  [6]
 LDCM0572  Fragment10 Ramos 1.25  LDD2189  [6]
 LDCM0573  Fragment11 Ramos 0.02  LDD2190  [6]
 LDCM0574  Fragment12 Ramos 0.89  LDD2191  [6]
 LDCM0575  Fragment13 Ramos 1.20  LDD2192  [6]
 LDCM0576  Fragment14 Ramos 0.54  LDD2193  [6]
 LDCM0579  Fragment20 Ramos 1.61  LDD2194  [6]
 LDCM0580  Fragment21 Ramos 0.83  LDD2195  [6]
 LDCM0582  Fragment23 Ramos 0.92  LDD2196  [6]
 LDCM0578  Fragment27 Ramos 0.88  LDD2197  [6]
 LDCM0586  Fragment28 Ramos 0.82  LDD2198  [6]
 LDCM0588  Fragment30 Ramos 1.03  LDD2199  [6]
 LDCM0589  Fragment31 Ramos 1.15  LDD2200  [6]
 LDCM0590  Fragment32 Ramos 0.73  LDD2201  [6]
 LDCM0468  Fragment33 Ramos 0.76  LDD2202  [6]
 LDCM0596  Fragment38 Ramos 0.99  LDD2203  [6]
 LDCM0566  Fragment4 Ramos 1.72  LDD2184  [6]
 LDCM0610  Fragment52 Ramos 1.71  LDD2204  [6]
 LDCM0614  Fragment56 Ramos 1.59  LDD2205  [6]
 LDCM0569  Fragment7 Ramos 1.21  LDD2186  [6]
 LDCM0571  Fragment9 Ramos 1.40  LDD2188  [6]
 LDCM0022  KB02 Ramos 1.47  LDD2182  [6]
 LDCM0023  KB03 Ramos 1.40  LDD2183  [6]
 LDCM0024  KB05 Ramos 1.00  LDD2185  [6]
 LDCM0514  Nucleophilic fragment 20a MDA-MB-231 C2(0.74)  LDD2107  [2]
 LDCM0535  Nucleophilic fragment 30b MDA-MB-231 C2(1.23)  LDD2128  [2]
 LDCM0627  NUDT7-COV-1 HEK-293T C2(0.79)  LDD2206  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Transporter and channel
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gamma-secretase subunit APH-1B (APH1B) APH-1 family Q8WW43
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Gap junction beta-1 protein (GJB1) Connexin family P08034
Gap junction beta-4 protein (GJB4) Connexin family Q9NTQ9
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Potassium channel subfamily K member 5 (KCNK5) Two pore domain potassium channel (TC 1.A.1.8) family O95279
GPCR
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Free fatty acid receptor 2 (FFAR2) G-protein coupled receptor 1 family O15552
G-protein coupled receptor 37-like 1 (GPR37L1) G-protein coupled receptor 1 family O60883
G-protein coupled receptor 42 (GPR42) G-protein coupled receptor 1 family O15529
Probable G-protein coupled receptor 101 (GPR101) G-protein coupled receptor 1 family Q96P66
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
CKLF-like MARVEL transmembrane domain-containing protein 2 (CMTM2) Chemokine-like factor family Q8TAZ6
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Gap junction beta-5 protein (GJB5) Connexin family O95377
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
C-type lectin domain family 17, member A (CLEC17A) . Q6ZS10
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.
2 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
3 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
4 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
7 Rapid Covalent-Probe Discovery by Electrophile-Fragment Screening. J Am Chem Soc. 2019 Jun 5;141(22):8951-8968. doi: 10.1021/jacs.9b02822. Epub 2019 May 22.