Details of the Target

General Information of Target

Target ID LDTP03942
Target Name Protein phosphatase inhibitor 2 (PPP1R2)
Gene Name PPP1R2
Gene ID 5504
Synonyms
IPP2; Protein phosphatase inhibitor 2; IPP-2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPAD
KDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQE
SSGEEDSDLSPEEREKKRQFEMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADG
ESMNTEESNQGSTPSDQQQNKLRSS
Target Bioclass
Enzyme
Family
Protein phosphatase inhibitor 2 family
Function Inhibitor of protein-phosphatase 1.
Uniprot ID
P41236
Ensemble ID
ENST00000618156.5
HGNC ID
HGNC:9288

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 9 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
m-APA
 Probe Info  		15.00  LDD0402  [1]
STPyne
 Probe Info  		K143(0.99); K145(1.25); K155(1.20)  LDD0277  [2]
IA-alkyne
 Probe Info  		C86(10.00)  LDD2157  [3]
Probe 1
 Probe Info  		Y148(10.90)  LDD3495  [4]
HHS-475
 Probe Info  		Y148(0.81); Y56(0.83); Y63(1.11)  LDD0264  [5]
DBIA
 Probe Info  		C86(1.18)  LDD1492  [6]
5E-2FA
 Probe Info  		H8(0.00); H57(0.00)  LDD2235  [7]
AOyne
 Probe Info  		15.00  LDD0443  [8]
HHS-465
 Probe Info  		Y148(0.00); Y63(0.00); K61(0.00)  LDD2240  [9]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 15.00  LDD0403  [1]
 LDCM0625  F8 Ramos C86(0.95)  LDD2187  [10]
 LDCM0572  Fragment10 Ramos C86(1.43)  LDD2189  [10]
 LDCM0573  Fragment11 Ramos C86(3.32)  LDD2190  [10]
 LDCM0574  Fragment12 Ramos C86(1.39)  LDD2191  [10]
 LDCM0575  Fragment13 Ramos C86(2.02)  LDD2192  [10]
 LDCM0576  Fragment14 Ramos C86(0.55)  LDD2193  [10]
 LDCM0579  Fragment20 Ramos C86(0.98)  LDD2194  [10]
 LDCM0580  Fragment21 Ramos C86(1.45)  LDD2195  [10]
 LDCM0582  Fragment23 Ramos C86(1.15)  LDD2196  [10]
 LDCM0578  Fragment27 Ramos C86(2.03)  LDD2197  [10]
 LDCM0588  Fragment30 Ramos C86(2.19)  LDD2199  [10]
 LDCM0589  Fragment31 Ramos C86(2.35)  LDD2200  [10]
 LDCM0590  Fragment32 Ramos C86(1.64)  LDD2201  [10]
 LDCM0468  Fragment33 Ramos C86(2.02)  LDD2202  [10]
 LDCM0596  Fragment38 Ramos C86(1.64)  LDD2203  [10]
 LDCM0566  Fragment4 Ramos C86(2.00)  LDD2184  [10]
 LDCM0610  Fragment52 Ramos C86(2.15)  LDD2204  [10]
 LDCM0614  Fragment56 Ramos C86(1.70)  LDD2205  [10]
 LDCM0569  Fragment7 Ramos C86(0.80)  LDD2186  [10]
 LDCM0571  Fragment9 Ramos C86(0.98)  LDD2188  [10]
 LDCM0116  HHS-0101 DM93 Y148(0.81); Y56(0.83); Y63(1.11)  LDD0264  [5]
 LDCM0117  HHS-0201 DM93 Y63(0.43); Y148(0.64); Y56(1.21)  LDD0265  [5]
 LDCM0118  HHS-0301 DM93 Y63(0.48); Y56(0.54); Y148(0.71)  LDD0266  [5]
 LDCM0119  HHS-0401 DM93 Y148(0.71); Y63(0.86); Y56(0.95)  LDD0267  [5]
 LDCM0120  HHS-0701 DM93 Y56(0.58); Y148(0.83); Y63(0.88)  LDD0268  [5]
 LDCM0022  KB02 HEK-293T C86(1.18)  LDD1492  [6]
 LDCM0023  KB03 HEK-293T C86(0.96)  LDD1497  [6]
 LDCM0024  KB05 HEK-293T C86(0.97)  LDD1502  [6]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) PPP phosphatase family P62136
Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (PPP1CC) PPP phosphatase family P36873
Serine/threonine-protein kinase LMTK2 (LMTK2) Tyr protein kinase family Q8IWU2
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Amyloid-beta precursor protein (APP) APP family P05067
Other
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
TERF1-interacting nuclear factor 2 (TINF2) . Q9BSI4

References

1 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
2 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
3 From chemoproteomic-detected amino acids to genomic coordinates: insights into precise multi-omic data integration. Mol Syst Biol. 2021 Feb;17(2):e9840. doi: 10.15252/msb.20209840.
Mass spectrometry data entry: PXD022151
4 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
5 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
6 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
7 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
8 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.
9 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010
10 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578