Details of the Target

General Information of Target

Target ID LDTP03931
Target Name Peripherin (PRPH)
Gene Name PRPH
Gene ID 5630
Synonyms
NEF4; PRPH1; Peripherin; Neurofilament 4
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSF
RSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQ
QNAALRGELSQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALK
QRLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQ
VSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANR
NHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAAR
LEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK
TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Target Bioclass
Other
Family
Intermediate filament family
Subcellular location
Cytoplasm, cytoskeleton
Function
Class-III neuronal intermediate filament protein. May form an independent structural network without the involvement of other neurofilaments or may cooperate with the neuronal intermediate filament proteins NEFL, NEFH, NEFM and INA to form a filamentous network. Assembly of the neuronal intermediate filaments may be regulated by RAB7A. Plays a role in the development of unmyelinated sensory neurons. May be involved in axon elongation and axon regeneration after injury. Inhibits neurite extension in type II spiral ganglion neurons in the cochlea.
Uniprot ID
P41219
Ensemble ID
ENST00000257860.9
HGNC ID
HGNC:9461

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
8505C SNV: p.A138P .
BICR22 SNV: p.E461Q .
COLO792 SNV: p.E311K .
DU145 SNV: p.R162C; p.N313K .
ETK1 SNV: p.V251G .
HCT15 SNV: p.E234D; p.L349P .
KYSE180 SNV: p.E427Q .
NCIH358 SNV: p.G353S .
OVCAR5 SNV: p.A140D .
SKNSH SNV: p.Y17S .
SW756 SNV: p.F12L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 6 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AZ-9
 Probe Info  		E404(0.78); E284(1.15); E282(1.18); E285(1.07)  LDD2208  [1]
IPM
 Probe Info  		C144(3.05)  LDD2229  [2]
HHS-475
 Probe Info  		Y287(0.79)  LDD0264  [3]
Acrolein
 Probe Info  		N.A.  LDD0227  [4]
TPP-AC
 Probe Info  		N.A.  LDD0427  [5]
HHS-465
 Probe Info  		K288(0.00); Y287(0.00); K398(0.00)  LDD2240  [6]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0116  HHS-0101 DM93 Y287(0.79)  LDD0264  [3]
 LDCM0117  HHS-0201 DM93 Y287(0.68)  LDD0265  [3]
 LDCM0118  HHS-0301 DM93 Y287(0.68)  LDD0266  [3]
 LDCM0119  HHS-0401 DM93 Y287(0.78)  LDD0267  [3]
 LDCM0120  HHS-0701 DM93 Y287(0.80)  LDD0268  [3]
 LDCM0109  NEM HeLa N.A.  LDD0227  [4]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
COP9 signalosome complex subunit 3 (COPS3) CSN3 family Q9UNS2
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
E3 SUMO-protein ligase PIAS1 (PIAS1) PIAS family O75925
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2) CAMK Ser/Thr protein kinase family P54646
Atlastin-1 (ATL1) GB1/RHD3 GTPase family Q8WXF7
RING finger protein 112 (RNF112) GB1/RHD3 GTPase family Q9ULX5
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
E3 ubiquitin-protein ligase RNF183 (RNF183) . Q96D59
pre-mRNA splicing regulator USH1G (USH1G) . Q495M9
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hsp90 co-chaperone Cdc37 (CDC37) CDC37 family Q16543
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Alpha-crystallin A chain (CRYAA) Small heat shock protein (HSP20) family P02489
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 232 (ZNF232) Krueppel C2H2-type zinc-finger protein family Q9UNY5
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Paired mesoderm homeobox protein 2A (PHOX2A) Paired homeobox family O14813
Neurogenic differentiation factor 1 (NEUROD1) . Q13562
Other
Click To Hide/Show 40 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apoptosis-stimulating of p53 protein 1 (PPP1R13B) ASPP family Q96KQ4
Protein BRICK1 (BRK1) BRK1 family Q8WUW1
Protein FAM167A (FAM167A) FAM167 (SEC) family Q96KS9
Centromere protein V (CENPV) Gfa family Q7Z7K6
HAUS augmin-like complex subunit 7 (HAUS7) HAUS7 family Q99871
Protein INCA1 (INCA1) INCA family Q0VD86
Desmin (DES) Intermediate filament family P17661
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha3-II (KRT33B) Intermediate filament family Q14525
Keratin, type I cytoskeletal 14 (KRT14) Intermediate filament family P02533
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Keratin, type I cytoskeletal 19 (KRT19) Intermediate filament family P08727
Keratin, type I cytoskeletal 20 (KRT20) Intermediate filament family P35900
Keratin, type I cytoskeletal 24 (KRT24) Intermediate filament family Q2M2I5
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Vimentin (VIM) Intermediate filament family P08670
Kinesin light chain 3 (KLC3) Kinesin light chain family Q6P597
Lebercilin-like protein (LCA5L) LCA5 family O95447
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
RUS family member 1 (RUSF1) RUS1 family Q96GQ5
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
SNW domain-containing protein 1 (SNW1) SNW family Q13573
T-complex protein 10A homolog 1 (TCP10L) TCP10 family Q8TDR4
CST complex subunit TEN1 (TEN1) TEN1 family Q86WV5
Transcription elongation factor A protein 2 (TCEA2) TFS-II family Q15560
Transmembrane protein 54 (TMEM54) TMEM54 family Q969K7
BTB/POZ domain-containing protein KCTD17 (KCTD17) . Q8N5Z5
Cancer/testis antigen 55 (CT55) . Q8WUE5
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Enkurin (ENKUR) . Q8TC29
Leucine rich adaptor protein 1-like (LURAP1L) . Q8IV03
Leukocyte receptor cluster member 1 (LENG1) . Q96BZ8
Phostensin (PPP1R18) . Q6NYC8
Protein phosphatase 1 regulatory inhibitor subunit 16B (PPP1R16B) . Q96T49
Splicing regulator RBM11 (RBM11) . P57052
Uncharacterized protein KIAA0408 (KIAA0408) . Q6ZU52
Zinc finger C4H2 domain-containing protein (ZC4H2) . Q9NQZ6
Zinc finger matrin-type protein 2 (ZMAT2) . Q96NC0

References

1 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
2 A quantitative thiol reactivity profiling platform to analyze redox and electrophile reactive cysteine proteomes. Nat Protoc. 2020 Sep;15(9):2891-2919. doi: 10.1038/s41596-020-0352-2. Epub 2020 Jul 20.
Mass spectrometry data entry: PXD016048
3 Discovery of a Cell-Active SuTEx Ligand of Prostaglandin Reductase 2. Chembiochem. 2021 Jun 15;22(12):2134-2139. doi: 10.1002/cbic.202000879. Epub 2021 Apr 29.
4 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
5 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.
6 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010