Details of the Target
General Information of Target
| Target ID | LDTP03931 | |||||
|---|---|---|---|---|---|---|
| Target Name | Peripherin (PRPH) | |||||
| Gene Name | PRPH | |||||
| Gene ID | 5630 | |||||
| Synonyms |
NEF4; PRPH1; Peripherin; Neurofilament 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSF
RSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQ QNAALRGELSQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALK QRLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQ VSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANR NHEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAAR LEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIK TTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Intermediate filament family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Class-III neuronal intermediate filament protein. May form an independent structural network without the involvement of other neurofilaments or may cooperate with the neuronal intermediate filament proteins NEFL, NEFH, NEFM and INA to form a filamentous network. Assembly of the neuronal intermediate filaments may be regulated by RAB7A. Plays a role in the development of unmyelinated sensory neurons. May be involved in axon elongation and axon regeneration after injury. Inhibits neurite extension in type II spiral ganglion neurons in the cochlea.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
![]() |
E404(0.78); E284(1.15); E282(1.18); E285(1.07) | LDD2208 | [1] | |
|
IPM Probe Info |
![]() |
C144(3.05) | LDD2229 | [2] | |
|
HHS-475 Probe Info |
![]() |
Y287(0.79) | LDD0264 | [3] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0227 | [4] | |
|
TPP-AC Probe Info |
![]() |
N.A. | LDD0427 | [5] | |
|
HHS-465 Probe Info |
![]() |
K288(0.00); Y287(0.00); K398(0.00) | LDD2240 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y287(0.79) | LDD0264 | [3] |
| LDCM0117 | HHS-0201 | DM93 | Y287(0.68) | LDD0265 | [3] |
| LDCM0118 | HHS-0301 | DM93 | Y287(0.68) | LDD0266 | [3] |
| LDCM0119 | HHS-0401 | DM93 | Y287(0.78) | LDD0267 | [3] |
| LDCM0120 | HHS-0701 | DM93 | Y287(0.80) | LDD0268 | [3] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0227 | [4] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
Transcription factor
Other
References






