Details of the Target
General Information of Target
| Target ID | LDTP03890 | |||||
|---|---|---|---|---|---|---|
| Target Name | B-cell antigen receptor complex-associated protein beta chain (CD79B) |
|
||||
| Gene Name | CD79B | |||||
| Gene ID | 974 | |||||
| Synonyms |
B29; IGB; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b |
|||||
| 3D Structure | ||||||
| Sequence |
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C122(1.85) | LDD2183 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C122(1.26) | LDD2187 | [1] |
| LDCM0573 | Fragment11 | Ramos | C122(1.08) | LDD2190 | [1] |
| LDCM0574 | Fragment12 | Ramos | C122(2.45) | LDD2191 | [1] |
| LDCM0575 | Fragment13 | Ramos | C122(1.03) | LDD2192 | [1] |
| LDCM0576 | Fragment14 | Ramos | C122(1.63) | LDD2193 | [1] |
| LDCM0580 | Fragment21 | Ramos | C122(1.02) | LDD2195 | [1] |
| LDCM0582 | Fragment23 | Ramos | C122(0.92) | LDD2196 | [1] |
| LDCM0578 | Fragment27 | Ramos | C122(0.80) | LDD2197 | [1] |
| LDCM0586 | Fragment28 | Ramos | C122(0.78) | LDD2198 | [1] |
| LDCM0588 | Fragment30 | Ramos | C122(1.01) | LDD2199 | [1] |
| LDCM0589 | Fragment31 | Ramos | C122(1.02) | LDD2200 | [1] |
| LDCM0590 | Fragment32 | Ramos | C122(1.94) | LDD2201 | [1] |
| LDCM0468 | Fragment33 | Ramos | C122(0.89) | LDD2202 | [1] |
| LDCM0596 | Fragment38 | Ramos | C122(0.65) | LDD2203 | [1] |
| LDCM0566 | Fragment4 | Ramos | C122(0.85) | LDD2184 | [1] |
| LDCM0610 | Fragment52 | Ramos | C122(0.86) | LDD2204 | [1] |
| LDCM0614 | Fragment56 | Ramos | C122(1.09) | LDD2205 | [1] |
| LDCM0569 | Fragment7 | Ramos | C122(0.18) | LDD2186 | [1] |
| LDCM0023 | KB03 | Ramos | C122(1.85) | LDD2183 | [1] |
| LDCM0024 | KB05 | Ramos | C122(1.54) | LDD2185 | [1] |