Details of the Target
General Information of Target
| Target ID | LDTP03687 | |||||
|---|---|---|---|---|---|---|
| Target Name | Macrosialin (CD68) |
|
||||
| Gene Name | CD68 | |||||
| Gene ID | 968 | |||||
| Synonyms |
Macrosialin; Gp110; CD antigen CD68 |
|||||
| 3D Structure | ||||||
| Sequence |
MRLAVLFSGALLGLLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTT
THRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNAT VHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRV MYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSY MAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAA QLPHTGVFGQSFSCPSDRSILLPLIIGLILLGLLALVLIAFCIIRRRPSAYQAL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
LAMP family
|
|||||
| Subcellular location |
Endosome membrane; Cell membrane
|
|||||
| Function |
Could play a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. Binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K58(4.67) | LDD0277 | [1] | |
|
BTD Probe Info |
 |
C24(0.51) | LDD1700 | [2] | |
|
IPM Probe Info |
 |
C24(4.35) | LDD1701 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0548 | 1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one | MDA-MB-231 | C24(0.89) | LDD2142 | [2] |
| LDCM0519 | 1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one | MDA-MB-231 | C24(1.08) | LDD2112 | [2] |
| LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C314(6.78); C24(1.34) | LDD1702 | [2] |
| LDCM0023 | KB03 | MDA-MB-231 | C24(4.35) | LDD1701 | [2] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C24(0.81) | LDD2092 | [2] |
| LDCM0500 | Nucleophilic fragment 13a | MDA-MB-231 | C24(0.79) | LDD2093 | [2] |
| LDCM0501 | Nucleophilic fragment 13b | MDA-MB-231 | C24(1.21) | LDD2094 | [2] |
| LDCM0505 | Nucleophilic fragment 15b | MDA-MB-231 | C24(0.74) | LDD2098 | [2] |
| LDCM0507 | Nucleophilic fragment 16b | MDA-MB-231 | C24(0.87) | LDD2100 | [2] |
| LDCM0511 | Nucleophilic fragment 18b | MDA-MB-231 | C24(0.81) | LDD2104 | [2] |
| LDCM0515 | Nucleophilic fragment 20b | MDA-MB-231 | C24(0.89) | LDD2108 | [2] |
| LDCM0518 | Nucleophilic fragment 22a | MDA-MB-231 | C24(0.36) | LDD2111 | [2] |
| LDCM0521 | Nucleophilic fragment 23b | MDA-MB-231 | C24(0.82) | LDD2114 | [2] |
| LDCM0211 | Nucleophilic fragment 3b | MDA-MB-231 | C24(0.51) | LDD1700 | [2] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C24(0.61) | LDD2141 | [2] |
| LDCM0551 | Nucleophilic fragment 5b | MDA-MB-231 | C24(8.36) | LDD2145 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Anterior gradient protein 2 homolog (AGR2) | AGR family | O95994 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Aquaporin-6 (AQP6) | MIP/aquaporin (TC 1.A.8) family | Q13520 | |||
| Transmembrane protein 179B (TMEM179B) | TMEM179 family | Q7Z7N9 | |||
Other
References