Details of the Target
General Information of Target
Target ID | LDTP03647 | |||||
---|---|---|---|---|---|---|
Target Name | Guanylate-binding protein 2 (GBP2) | |||||
Gene Name | GBP2 | |||||
Gene ID | 2634 | |||||
Synonyms |
Guanylate-binding protein 2; EC 3.6.5.-; GTP-binding protein 2; GBP-2; HuGBP-2; Guanine nucleotide-binding protein 2; Interferon-induced guanylate-binding protein 2 |
|||||
3D Structure | ||||||
Sequence |
MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAI LLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTL RDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPA PKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLVLTYVN AISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQELLDLHRDSER EAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSL SEKEKAIEVERIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQL MAEQEKTLALKLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3 GTPase family, GB1 subfamily
|
|||||
Subcellular location |
Cytoplasmic vesicle membrane
|
|||||
Function |
Interferon (IFN)-inducible GTPase that plays important roles in innate immunity against a diverse range of bacterial, viral and protozoan pathogens. Hydrolyzes GTP to GMP in 2 consecutive cleavage reactions, but the major reaction product is GDP. Following infection, recruited to the pathogen-containing vacuoles or vacuole-escaped bacteria and acts as a positive regulator of inflammasome assembly by promoting the release of inflammasome ligands from bacteria. Acts by promoting lysis of pathogen-containing vacuoles, releasing pathogens into the cytosol. Following pathogen release in the cytosol, promotes recruitment of proteins that mediate bacterial cytolysis: this liberates ligands that are detected by inflammasomes, such as lipopolysaccharide (LPS) that activates the non-canonical CASP4/CASP11 inflammasome or double-stranded DNA (dsDNA) that activates the AIM2 inflammasome. Confers protection to the protozoan pathogen Toxoplasma gondii. Independently of its GTPase activity, acts as an inhibitor of various viruses infectivity, such as HIV-1, Zika and influenza A viruses, by inhibiting FURIN-mediated maturation of viral envelope proteins.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
STPyne Probe Info |
![]() |
K381(1.21); K395(1.37); K442(8.28); K456(8.48) | LDD0277 | [1] | |
ONAyne Probe Info |
![]() |
K442(8.06) | LDD0275 | [1] | |
DBIA Probe Info |
![]() |
C82(2.03) | LDD3310 | [2] | |
Jackson_1 Probe Info |
![]() |
20.00 | LDD0121 | [3] | |
Acrolein Probe Info |
![]() |
N.A. | LDD0225 | [4] | |
IA-alkyne Probe Info |
![]() |
C233(0.00); C404(0.00); C394(0.00) | LDD0162 | [5] | |
NAIA_5 Probe Info |
![]() |
C233(0.00); C394(0.00) | LDD2223 | [6] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
References