Details of the Target
General Information of Target
Target ID | LDTP03376 | |||||
---|---|---|---|---|---|---|
Target Name | Interleukin-3 receptor subunit alpha (IL3RA) | |||||
Gene Name | IL3RA | |||||
Gene ID | 3563 | |||||
Synonyms |
IL3R; Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; CD antigen CD123 |
|||||
3D Structure | ||||||
Sequence |
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG KAGLEECLVTEVQVVQKT |
|||||
Target Type |
Successful
|
|||||
Target Bioclass |
Cytokine and receptor
|
|||||
Family |
Type I cytokine receptor family, Type 5 subfamily
|
|||||
Subcellular location |
Membrane
|
|||||
Function |
Cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes and B-lymphocytes that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Ligand stimulation rapidly induces hetrodimerization with IL3RB, phosphorylation and enzyme activity of effector proteins such as JAK2 and PI3K that play a role in signaling cell proliferation and differentiation. Activation of JAK2 leads to STAT5-mediated transcriptional program.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C151(1.08) | LDD1573 | [1] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0369 | CL100 | HEK-293T | C151(1.08) | LDD1573 | [1] |
LDCM0373 | CL104 | HEK-293T | C151(0.78) | LDD1577 | [1] |
LDCM0377 | CL108 | HEK-293T | C151(0.72) | LDD1581 | [1] |
LDCM0382 | CL112 | HEK-293T | C151(0.80) | LDD1586 | [1] |
LDCM0386 | CL116 | HEK-293T | C151(0.86) | LDD1590 | [1] |
LDCM0391 | CL120 | HEK-293T | C151(0.84) | LDD1595 | [1] |
LDCM0395 | CL124 | HEK-293T | C151(0.47) | LDD1599 | [1] |
LDCM0399 | CL128 | HEK-293T | C151(0.94) | LDD1603 | [1] |
LDCM0403 | CL16 | HEK-293T | C151(0.97) | LDD1607 | [1] |
LDCM0416 | CL28 | HEK-293T | C151(0.81) | LDD1620 | [1] |
LDCM0429 | CL4 | HEK-293T | C151(1.28) | LDD1633 | [1] |
LDCM0430 | CL40 | HEK-293T | C151(1.20) | LDD1634 | [1] |
LDCM0443 | CL52 | HEK-293T | C151(0.97) | LDD1646 | [1] |
LDCM0456 | CL64 | HEK-293T | C151(0.93) | LDD1659 | [1] |
LDCM0469 | CL76 | HEK-293T | C151(0.98) | LDD1672 | [1] |
LDCM0482 | CL88 | HEK-293T | C151(1.24) | LDD1685 | [1] |