Details of the Target
General Information of Target
| Target ID | LDTP03204 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA repair protein complementing XP-A cells (XPA) | |||||
| Gene Name | XPA | |||||
| Gene ID | 7507 | |||||
| Synonyms |
XPAC; DNA repair protein complementing XP-A cells; Xeroderma pigmentosum group A-complementing protein |
|||||
| 3D Structure | ||||||
| Sequence |
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM |
|||||
| Target Type |
Literature-reported
|
|||||
| Target Bioclass |
Other
|
|||||
| Family |
XPA family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AHL-Pu-1 Probe Info |
![]() |
C153(3.05) | LDD0168 | [1] | |
|
DBIA Probe Info |
![]() |
C126(0.99); C129(0.99); C105(1.08); C108(1.08) | LDD0080 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [3] | |
|
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0025 | 4SU-RNA | HEK-293T | C153(3.05) | LDD0168 | [1] |
| LDCM0022 | KB02 | HCT 116 | C126(0.99); C129(0.99); C105(1.08); C108(1.08) | LDD0080 | [2] |
| LDCM0023 | KB03 | HCT 116 | C126(1.40); C129(1.40); C105(1.51); C108(1.51) | LDD0081 | [2] |
| LDCM0024 | KB05 | HCT 116 | C126(1.91); C129(1.91); C105(1.64); C108(1.64) | LDD0082 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger protein 655 (ZNF655) | Krueppel C2H2-type zinc-finger protein family | Q8N720 | |||
| AT-rich interactive domain-containing protein 3A (ARID3A) | . | Q99856 | |||
Other
References





