Details of the Target
General Information of Target
| Target ID | LDTP03177 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cornifin-B (SPRR1B) | |||||
| Gene Name | SPRR1B | |||||
| Gene ID | 6699 | |||||
| Synonyms |
Cornifin-B; 14.9 kDa pancornulin; Small proline-rich protein IB; SPR-IB |
|||||
| 3D Structure | ||||||
| Sequence |
MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPK
VPEPCHPKVPEPCPSIVTPAPAQQKTKQK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Cornifin (SPRR) family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. Can function as both amine donor and acceptor in transglutaminase-mediated cross-linkage.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C57(2.61) | LDD3312 | [1] | |
|
BTD Probe Info |
 |
C65(0.62); C49(0.62); C41(0.62) | LDD2092 | [2] | |
|
IA-alkyne Probe Info |
 |
C41(0.00); C57(0.00) | LDD0162 | [3] | |
|
ATP probe Probe Info |
 |
N.A. | LDD0035 | [4] | |
|
MPP-AC Probe Info |
 |
N.A. | LDD0428 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0022 | KB02 | A431 | C49(2.02); C73(2.13); C57(2.12) | LDD2258 | [1] |
| LDCM0023 | KB03 | A431 | C49(2.01); C73(2.08); C57(2.07) | LDD2675 | [1] |
| LDCM0024 | KB05 | HMCB | C57(2.61) | LDD3312 | [1] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C65(0.62); C49(0.62); C41(0.62) | LDD2092 | [2] |
References