Details of the Target

General Information of Target

Target ID LDTP03057
Target Name Interferon-induced GTP-binding protein Mx1 (MX1)
Gene Name MX1
Gene ID 4599
Synonyms
Interferon-induced GTP-binding protein Mx1; Interferon-induced protein p78; IFI-78K; Interferon-regulated resistance GTP-binding protein MxA; Myxoma resistance protein 1; Myxovirus resistance protein 1) [Cleaved into: Interferon-induced GTP-binding protein Mx1, N-terminally processed]
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG
Target Bioclass
Enzyme
Family
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular location
Cytoplasm
Function
Interferon-induced dynamin-like GTPase with antiviral activity against a wide range of RNA viruses and some DNA viruses. Its target viruses include negative-stranded RNA viruses and HBV through binding and inactivation of their ribonucleocapsid. May also antagonize reoviridae and asfarviridae replication. Inhibits thogoto virus (THOV) replication by preventing the nuclear import of viral nucleocapsids. Inhibits La Crosse virus (LACV) replication by sequestering viral nucleoprotein in perinuclear complexes, preventing genome amplification, budding, and egress. Inhibits influenza A virus (IAV) replication by decreasing or delaying NP synthesis and by blocking endocytic traffic of incoming virus particles. Enhances ER stress-mediated cell death after influenza virus infection. May regulate the calcium channel activity of TRPCs.
Uniprot ID
P20591
Ensemble ID
ENST00000398598.8
HGNC ID
HGNC:7532

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AU565 SNV: p.R649Q .
COLO792 SNV: p.P218L .
MCC13 SNV: p.M1? .
MINO SNV: p.G540D .
TE4 SNV: p.K554Ter .
YSCCC SNV: p.Q529H .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K459(10.00); K544(6.90)  LDD0277  [1]
OPA-S-S-alkyne
 Probe Info  		K505(2.52)  LDD3494  [2]
DBIA
 Probe Info  		C533(1.19); C42(0.87)  LDD0078  [3]
IA-alkyne
 Probe Info  		N.A.  LDD0167  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0020  ARS-1620 HCC44 C533(1.19); C42(0.87)  LDD0078  [3]
 LDCM0625  F8 Ramos C52(0.76); C336(0.56); C42(1.50)  LDD2187  [5]
 LDCM0572  Fragment10 Ramos C52(0.85); C42(1.14)  LDD2189  [5]
 LDCM0573  Fragment11 Ramos C52(0.73); C42(3.94)  LDD2190  [5]
 LDCM0574  Fragment12 Ramos C52(1.73); C42(0.91)  LDD2191  [5]
 LDCM0575  Fragment13 Ramos C52(0.96); C42(0.84)  LDD2192  [5]
 LDCM0576  Fragment14 Ramos C52(1.55); C336(1.35); C42(0.87)  LDD2193  [5]
 LDCM0579  Fragment20 Ramos C52(1.93)  LDD2194  [5]
 LDCM0580  Fragment21 Ramos C52(0.93); C42(1.10)  LDD2195  [5]
 LDCM0582  Fragment23 Ramos C52(1.72); C42(0.72)  LDD2196  [5]
 LDCM0578  Fragment27 Ramos C52(0.97); C42(1.11)  LDD2197  [5]
 LDCM0586  Fragment28 Ramos C52(1.03); C336(1.54); C42(0.61)  LDD2198  [5]
 LDCM0588  Fragment30 Ramos C52(0.86); C42(1.15)  LDD2199  [5]
 LDCM0589  Fragment31 Ramos C52(1.14); C42(0.81)  LDD2200  [5]
 LDCM0590  Fragment32 Ramos C52(1.25); C42(2.68)  LDD2201  [5]
 LDCM0468  Fragment33 Ramos C52(0.74); C42(0.94)  LDD2202  [5]
 LDCM0596  Fragment38 Ramos C52(1.05); C42(0.75)  LDD2203  [5]
 LDCM0566  Fragment4 Ramos C52(1.26); C336(1.25); C42(0.66)  LDD2184  [5]
 LDCM0610  Fragment52 Ramos C52(1.44)  LDD2204  [5]
 LDCM0614  Fragment56 Ramos C52(0.94); C42(0.92)  LDD2205  [5]
 LDCM0569  Fragment7 Ramos C52(1.29); C336(1.01); C42(0.58)  LDD2186  [5]
 LDCM0571  Fragment9 Ramos C52(2.07)  LDD2188  [5]
 LDCM0022  KB02 T cell-activated C533(8.01)  LDD1708  [6]
 LDCM0023  KB03 Ramos C52(3.72); C336(1.52); C42(1.15)  LDD2183  [5]
 LDCM0024  KB05 G361 C322(9.31); C336(3.24)  LDD3311  [7]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
E3 ubiquitin-protein ligase SIAH1 (SIAH1) SINA (Seven in absentia) family Q8IUQ4
Interferon-induced GTP-binding protein Mx1 (MX1) Dynamin/Fzo/YdjA family P20591
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Short transient receptor potential channel 3 (TRPC3) Transient receptor family Q13507
Short transient receptor potential channel 4 (TRPC4) Transient receptor family Q9UBN4
Short transient receptor potential channel 6 (TRPC6) Transient receptor family Q9Y210
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Calcium-binding protein 39-like (CAB39L) Mo25 family Q9H9S4
Galectin-3-binding protein (LGALS3BP) . Q08380
Mitochondrial coiled-coil domain protein 1 (MCCD1) . P59942

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
3 Reimagining high-throughput profiling of reactive cysteines for cell-based screening of large electrophile libraries. Nat Biotechnol. 2021 May;39(5):630-641. doi: 10.1038/s41587-020-00778-3. Epub 2021 Jan 4.
4 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
5 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
6 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.
7 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840