Details of the Target
General Information of Target
| Target ID | LDTP03035 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine protease inhibitor Kazal-type 2 (SPINK2) | |||||
| Gene Name | SPINK2 | |||||
| Gene ID | 6691 | |||||
| Synonyms |
Serine protease inhibitor Kazal-type 2; Acrosin-trypsin inhibitor; Epididymis tissue protein Li 172; HUSI-II |
|||||
| 3D Structure | ||||||
| Sequence |
MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYA
NECTLCMKIREGGHNIKIIRNGPC |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
As a strong inhibitor of acrosin, it is required for normal spermiogenesis. It probably hinders premature activation of proacrosin and other proteases, thus preventing the cascade of events leading to spermiogenesis defects. May be involved in the regulation of serine protease-dependent germ cell apoptosis. It also inhibits trypsin.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TPP-AC Probe Info |
![]() |
N.A. | LDD0427 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Kallikrein-4 (KLK4) | Peptidase S1 family | Q9Y5K2 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Wolframin (WFS1) | . | O76024 | |||
Other

