Details of the Target

General Information of Target

Target ID	LDTP03018
Target Name	C-X-C motif chemokine 2 (CXCL2)
Gene Name	CXCL2
Gene ID	2920
Synonyms	GRO2; GROB; MIP2A; SCYB2; C-X-C motif chemokine 2; Growth-regulated protein beta; Gro-beta; Macrophage inflammatory protein 2-alpha; MIP2-alpha) [Cleaved into: GRO-beta(5-73; GRO-beta-T; Hematopoietic synergistic factor; HSF; SB-251353)]
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Target Type	Clinical trial
Target Bioclass	Cytokine and receptor
Family	Intercrine alpha (chemokine CxC) family
Subcellular location	Secreted
Function	Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity.
TTD ID	T96627
Uniprot ID	P19875
DrugMap ID	TTZF0K2
Ensemble ID	ENST00000508487.3
HGNC ID	HGNC:4603
ChEMBL ID	CHEMBL3286076

Probe(s) Labeling This Target

ABPP Probe

Click To Hide/Show 1 Probe Related to This Target

Probe name		Structure	Binding Site(Ratio)	Interaction ID	Ref
CY4 Probe Info			N.A.	LDD0247	[1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme

Click To Hide/Show 1 Protein(s) Interacting with This Target

Protein name				Family	Uniprot ID
Dipeptidyl peptidase 4 (DPP4)				Peptidase S9B family	P27487

Cytokine and receptor

Click To Hide/Show 3 Protein(s) Interacting with This Target

Protein name	Family	Uniprot ID
Platelet factor 4 (PF4)	Intercrine alpha (chemokine CxC) family	P02776
Stromal cell-derived factor 1 (CXCL12)	Intercrine alpha (chemokine CxC) family	P48061
C-C motif chemokine 5 (CCL5)	Intercrine beta (chemokine CC) family	P13501

The Drug(s) Related To This Target

Phase 3

Click To Hide/Show 1 Drug(s) Interacting with This Target

Drug Name				Drug Type	External ID
Laquinamod				Small molecular drug	D09INF

References

1	Cyclopropenone, Cyclopropeniminium Ion, and Cyclopropenethione as Novel Electrophilic Warheads for Potential Target Discovery of Triple-Negative Breast Cancer. J Med Chem. 2023 Feb 23;66(4):2851-2864. doi: 10.1021/acs.jmedchem.2c01889. Epub 2023 Feb 10.