Details of the Target

General Information of Target

Target ID LDTP02994
Target Name Leukocyte surface antigen CD53 (CD53)
Gene Name CD53
Gene ID 963
Synonyms
MOX44; TSPAN25; Leukocyte surface antigen CD53; Cell surface glycoprotein CD53; Tetraspanin-25; Tspan-25; CD antigen CD53
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVG
SIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTD
SIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
NFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Target Bioclass
Transporter and channel
Family
Tetraspanin (TM4SF) family
Subcellular location
Cell membrane
Function Required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells.
Uniprot ID
P19397
Ensemble ID
ENST00000271324.6
HGNC ID
HGNC:1686

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [1]
IA-alkyne
 Probe Info  		N.A.  LDD0166  [2]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
VE-P
 Probe Info  		N.A.  LDD0396  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
GTP-binding protein SAR1a (SAR1A) SAR1 family Q9NR31
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
GTPase IMAP family member 5 (GIMAP5) AIG1/Toc34/Toc159-like paraseptin GTPase family Q96F15
UbiA prenyltransferase domain-containing protein 1 (UBIAD1) UbiA prenyltransferase family Q9Y5Z9
V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C) V-ATPase proteolipid subunit family P27449
Transporter and channel
Click To Hide/Show 24 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Solute carrier family 7 member 14 (SLC7A14) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family Q8TBB6
Interferon-induced transmembrane protein 3 (IFITM3) CD225/Dispanin family Q01628
H(+)/Cl(-) exchange transporter 7 (CLCN7) Chloride channel (TC 2.A.49) family P51798
Claudin-7 (CLDN7) Claudin family O95471
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Protein cornichon homolog 1 (CNIH1) Cornichon family O95406
Protein cornichon homolog 2 (CNIH2) Cornichon family Q6PI25
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Protein GPR108 (GPR108) LU7TM family Q9NPR9
Myelin and lymphocyte protein (MAL) MAL family P21145
Membrane-spanning 4-domains subfamily A member 3 (MS4A3) MS4A family Q96HJ5
CMP-sialic acid transporter (SLC35A1) Nucleotide-sugar transporter family P78382
Cardiac phospholamban (PLN) Phospholamban family P26678
Peripheral myelin protein 22 (PMP22) PMP-22/EMP/MP20 family Q01453
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Uroplakin-1b (UPK1B) Tetraspanin (TM4SF) family O75841
Transmembrane protein 218 (TMEM218) TMEM218 family A2RU14
Sigma intracellular receptor 2 (TMEM97) TMEM97/sigma-2 receptor family Q5BJF2
Translocating chain-associated membrane protein 1-like 1 (TRAM1L1) TRAM family Q8N609
Translocator protein 2 (TSPO2) TspO/BZRP family Q5TGU0
Guided entry of tail-anchored proteins factor 1 (GET1) WRB/GET1 family O00258
Proteolipid protein 2 (PLP2) . Q04941
Sarcoplasmic/endoplasmic reticulum calcium ATPase regulator DWORF (STRIT1) . P0DN84
Transmembrane protein 60 (TMEM60) . Q9H2L4
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lysophosphatidic acid receptor 3 (LPAR3) G-protein coupled receptor 1 family Q9UBY5
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Immunoglobulin
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3) Immunoglobulin superfamily Q8N743
Butyrophilin subfamily 2 member A2 (BTN2A2) BTN/MOG family Q8WVV5
Other
Click To Hide/Show 23 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-like protein 13 (BCL2L13) Bcl-2 family Q9BXK5
Apolipoprotein D (APOD) Lipocalin family P05090
Cortexin-3 (CTXN3) Cortexin family Q4LDR2
Cytochrome b-245 chaperone 1 (CYBC1) CYBC1 family Q9BQA9
Ephrin-A5 (EFNA5) Ephrin family P52803
Ergosterol biosynthetic protein 28 homolog (ERG28) ERG28 family Q9UKR5
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Epithelial membrane protein 1 (EMP1) PMP-22/EMP/MP20 family P54849
Protein NKG7 (NKG7) PMP-22/EMP/MP20 family Q16617
Protein reprimo (RPRM) Reprimo family Q9NS64
Small cell adhesion glycoprotein (SMAGP) SMAGP family Q0VAQ4
Vesicle-associated membrane protein 5 (VAMP5) Synaptobrevin family O95183
Leukocyte antigen CD37 (CD37) Tetraspanin (TM4SF) family P11049
Transmembrane protein 229B (TMEM229B) TMEM229 family Q8NBD8
Bcl-2-interacting killer (BIK) . Q13323
CD302 antigen (CD302) . Q8IX05
Complement C1q-like protein 4 (C1QL4) . Q86Z23
Insulin-like growth factor-binding protein 5 (IGFBP5) . P24593
Leucine-rich single-pass membrane protein 1 (LSMEM1) . Q8N8F7
Protein SNORC (SNORC) . Q6UX34
Serine-rich and transmembrane domain-containing protein 1 (SERTM1) . A2A2V5
Small integral membrane protein 3 (SMIM3) . Q9BZL3
Transmembrane protein 140 (TMEM140) . Q9NV12

References

1 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
2 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
3 Pharmacological Targeting of Vacuolar H(+)-ATPase via Subunit V1G Combats Multidrug-Resistant Cancer. Cell Chem Biol. 2020 Nov 19;27(11):1359-1370.e8. doi: 10.1016/j.chembiol.2020.06.011. Epub 2020 Jul 9.