Details of the Target

General Information of Target

Target ID LDTP02968
Target Name Cyclic AMP-dependent transcription factor ATF-3 (ATF3)
Gene Name ATF3
Gene ID 467
Synonyms
Cyclic AMP-dependent transcription factor ATF-3; cAMP-dependent transcription factor ATF-3; Activating transcription factor 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S
Target Type
Literature-reported
Target Bioclass
Transcription factor
Family
BZIP family, ATF subfamily
Subcellular location
Nucleus
Function
This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter.; [Isoform 2]: Activates transcription presumably by sequestering inhibitory cofactors away from the promoters.; [Isoform 3]: Stress-induced isoform, counteracts the transcriptional repression of isoform 1.
TTD ID
T11966
Uniprot ID
P18847
DrugMap ID
TTCE793
Ensemble ID
ENST00000336937.8
HGNC ID
HGNC:785

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.S181R .
OE33 SNV: p.I19V .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K102(0.30)  LDD0277  [1]
DBIA
 Probe Info  		C153(1.27)  LDD1512  [2]
IPM
 Probe Info  		N.A.  LDD0005  [3]
VSF
 Probe Info  		N.A.  LDD0007  [3]
Phosphinate-6
 Probe Info  		N.A.  LDD0018  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0259  AC14 HEK-293T C153(1.27)  LDD1512  [2]
 LDCM0282  AC22 HEK-293T C153(1.48)  LDD1521  [2]
 LDCM0291  AC30 HEK-293T C153(1.22)  LDD1530  [2]
 LDCM0299  AC38 HEK-293T C153(1.31)  LDD1538  [2]
 LDCM0308  AC46 HEK-293T C153(1.54)  LDD1547  [2]
 LDCM0317  AC54 HEK-293T C153(1.23)  LDD1556  [2]
 LDCM0323  AC6 HEK-293T C153(1.16)  LDD1562  [2]
 LDCM0326  AC62 HEK-293T C153(1.16)  LDD1565  [2]
 LDCM0368  CL10 HEK-293T C153(1.53)  LDD1572  [2]
 LDCM0410  CL22 HEK-293T C153(0.99)  LDD1614  [2]
 LDCM0423  CL34 HEK-293T C153(0.84)  LDD1627  [2]
 LDCM0436  CL46 HEK-293T C153(1.11)  LDD1640  [2]
 LDCM0449  CL58 HEK-293T C153(0.97)  LDD1652  [2]
 LDCM0463  CL70 HEK-293T C153(0.92)  LDD1666  [2]
 LDCM0476  CL82 HEK-293T C153(1.41)  LDD1679  [2]
 LDCM0489  CL94 HEK-293T C153(1.38)  LDD1692  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) Peptidase C12 family P09936
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-synuclein (SNCA) Synuclein family P37840
Transcription factor
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Basic leucine zipper transcriptional factor ATF-like (BATF) BZIP family Q16520
Basic leucine zipper transcriptional factor ATF-like 3 (BATF3) BZIP family Q9NR55
Cyclic AMP-dependent transcription factor ATF-4 (ATF4) BZIP family P18848
Cyclic AMP-dependent transcription factor ATF-7 (ATF7) BZIP family P17544
DNA damage-inducible transcript 3 protein (DDIT3) BZIP family P35638
Cyclic AMP-dependent transcription factor ATF-3 (ATF3) BZIP family P18847
CCAAT/enhancer-binding protein alpha (CEBPA) BZIP family P49715
CCAAT/enhancer-binding protein epsilon (CEBPE) BZIP family Q15744
CCAAT/enhancer-binding protein gamma (CEBPG) BZIP family P53567
Nuclear factor erythroid 2-related factor 2 (NFE2L2) BZIP family Q16236
Protein c-Fos (FOS) BZIP family P01100
Transcription factor Jun (JUN) BZIP family P05412
Transcription factor JunB (JUNB) BZIP family P17275
Transcription factor JunD (JUND) BZIP family P17535
Transcription factor MafF (MAFF) BZIP family Q9ULX9
Nuclear factor of activated T-cells, cytoplasmic 1 (NFATC1) . O95644
Transcription factor p65 (RELA) . Q04206
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-dependent transcription factor ATF-2 (ATF2) BZIP family P15336
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Ataxin-1 (ATXN1) ATXN1 family P54253
Four and a half LIM domains protein 2 (FHL2) . Q14192
TAR DNA-binding protein 43 (TARDBP) . Q13148

The Drug(s) Related To This Target

Approved
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Pseudoephedrine Small molecular drug DB00852

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
3 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764
4 DFT-Guided Discovery of Ethynyl-Triazolyl-Phosphinates as Modular Electrophiles for Chemoselective Cysteine Bioconjugation and Profiling. Angew Chem Int Ed Engl. 2022 Oct 10;61(41):e202205348. doi: 10.1002/anie.202205348. Epub 2022 Aug 22.
Mass spectrometry data entry: PXD033004