Details of the Target

General Information of Target

Target ID LDTP02877
Target Name Zinc finger protein 20 (ZNF20)
Gene Name ZNF20
Gene ID 7568
Synonyms
KOX13; Zinc finger protein 20; Zinc finger protein KOX13
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMFQDSVAFEDVAVSFTQEEWALLDPSQKNLYRDVMQETFKNLTSVGKTWKVQNIEDEYK
NPRRNLSLMREKLCESKESHHCGESFNQIADDMLNRKTLPGITPCESSVCGEVGTGHSSL
NTHIRADTGHKSSEYQEYGENPYRNKECKKAFSYLDSFQSHDKACTKEKPYDGKECTETF
ISHSCIQRHRVMHSGDGPYKCKFCGKAFYFLNLCLIHERIHTGVKPYKCKQCGKAFTRST
TLPVHERTHTGVNADECKECGNAFSFPSEIRRHKRSHTGEKPYECKQCGKVFISFSSIQY
HKMTHTGEKPYECKQCGKAFRCGSHLQKHGRTHTGEKPYECRQCGKAFRCTSDLQRHEKT
HTEDKPYGCKQCGKGFRCASQLQIHERTHSGEKPHECKECGKVFKYFSSLRIHERTHTGE
KPHECKQCGKAFRYFSSLHIHERTHTGDKPYECKVCGKAFTCSSSIRYHERTHTGEKPYE
CKHCGKAFISNYIRYHERTHTGEKPYQCKQCGKAFIRASSCREHERTHTINR
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function May be involved in transcriptional regulation.
Uniprot ID
P17024
Ensemble ID
ENST00000334213.10
HGNC ID
HGNC:12992

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C378(1.12)  LDD3312  [1]
AHL-Pu-1
 Probe Info  		C9(2.31)  LDD0170  [2]
NAIA_4
 Probe Info  		N.A.  LDD2226  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C9(2.31)  LDD0170  [2]
 LDCM0026  4SU-RNA+native RNA DM93 C9(2.25)  LDD0171  [2]
 LDCM0022  KB02 ECC2 C378(2.09)  LDD2320  [1]
 LDCM0023  KB03 ECC2 C378(2.29)  LDD2737  [1]
 LDCM0024  KB05 HMCB C378(1.12)  LDD3312  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Actin, alpha skeletal muscle (ACTA1) Actin family P68133
Sodium/potassium-transporting ATPase subunit alpha-3 (ATP1A3) Cation transport ATPase (P-type) (TC 3.A.3) family P13637
Tyrosine--tRNA ligase, cytoplasmic (YARS1) Class-I aminoacyl-tRNA synthetase family P54577
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
Ras-related protein Rab-5A (RAB5A) Rab family P20339
GTP-binding protein GEM (GEM) RGK family P55040
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Junctophilin-3 (JPH3) Junctophilin family Q8WXH2
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Platelet endothelial cell adhesion molecule (PECAM1) . P16284
Other
Click To Hide/Show 31 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-hemoglobin-stabilizing protein (AHSP) AHSP family Q9NZD4
Cyclin-D1-binding protein 1 (CCNDBP1) CCNDBP1 family O95273
EF-hand calcium-binding domain-containing protein 4B (CRACR2A) EFCAB4 family Q9BSW2
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha8 (KRT38) Intermediate filament family O76015
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Prelamin-A/C (LMNA) Intermediate filament family P02545
Vimentin (VIM) Intermediate filament family P08670
Keratin-associated protein 10-5 (KRTAP10-5) KRTAP type 10 family P60370
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 12-3 (KRTAP12-3) KRTAP type 12 family P60328
Keratin-associated protein 4-12 (KRTAP4-12) KRTAP type 4 family Q9BQ66
Keratin-associated protein 4-2 (KRTAP4-2) KRTAP type 4 family Q9BYR5
Keratin-associated protein 9-2 (KRTAP9-2) KRTAP type 9 family Q9BYQ4
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Tektin-4 (TEKT4) Tektin family Q8WW24
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
G-protein-signaling modulator 3 (GPSM3) . Q9Y4H4
Merlin (NF2) . P35240
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TNF receptor-associated factor 1 (TRAF1) . Q13077
von Willebrand factor C and EGF domain-containing protein (VWCE) . Q96DN2
von Willebrand factor C domain-containing protein 2-like (VWC2L) . B2RUY7

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
3 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264