Details of the Target
General Information of Target
| Target ID | LDTP02477 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interleukin-8 (CXCL8) |
|
||||
| Gene Name | CXCL8 | |||||
| Gene ID | 3576 | |||||
| Synonyms |
IL8; Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8)77; GCP/IL-8 protein II; IL-8(1-77); IL8/NAP1 form II; MDNCF-b; IL-8(5-77; IL-8(6-77; (Ser-IL-8)72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8(7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8(8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8(9-77; GCP/IL-8 protein III; IL8/NAP1 form VI)]
|
|||||
| 3D Structure | ||||||
| Sequence |
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
|||||
| Target Type |
Successful
|
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Intercrine alpha (chemokine CxC) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Chemotactic factor that mediates inflammatory response by attracting neutrophils, basophils, and T-cells to clear pathogens and protect the host from infection. Also plays an important role in neutrophil activation. Released in response to an inflammatory stimulus, exerts its effect by binding to the G-protein-coupled receptors CXCR1 and CXCR2, primarily found in neutrophils, monocytes and endothelial cells. G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to CXCR1/CXCR2 receptor and activation by IL8 leads to beta and gamma subunits release from Galpha (GNAI2 in neutrophils) and activation of several downstream signaling pathways including PI3K and MAPK pathways.
|
|||||
| TTD ID | ||||||
| Uniprot ID | ||||||
| DrugMap ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C61(1.02) | LDD2379 | [1] | |
|
BTD Probe Info |
 |
C61(1.10) | LDD2101 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0022 | KB02 | ICC10 | C61(1.02) | LDD2379 | [1] |
| LDCM0023 | KB03 | ICC10 | C61(1.26) | LDD2796 | [1] |
| LDCM0024 | KB05 | ICC10 | C61(1.41) | LDD3213 | [1] |
| LDCM0508 | Nucleophilic fragment 17a | MDA-MB-231 | C61(1.10) | LDD2101 | [2] |
| LDCM0527 | Nucleophilic fragment 26b | MDA-MB-231 | C61(0.33) | LDD2120 | [2] |
| LDCM0541 | Nucleophilic fragment 36 | MDA-MB-231 | C61(0.50) | LDD2134 | [2] |
| LDCM0549 | Nucleophilic fragment 43 | MDA-MB-231 | C61(0.27) | LDD2143 | [2] |
| LDCM0553 | Nucleophilic fragment 6b | MDA-MB-231 | C61(0.31) | LDD2147 | [2] |
| LDCM0554 | Nucleophilic fragment 7a | MDA-MB-231 | C61(0.54) | LDD2148 | [2] |
References