Details of the Target
General Information of Target
| Target ID | LDTP01875 | |||||
|---|---|---|---|---|---|---|
| Target Name | Immunoglobulin J chain (JCHAIN) |
|
||||
| Gene Name | JCHAIN | |||||
| Gene ID | 3512 | |||||
| Synonyms |
IGCJ; IGJ; Immunoglobulin J chain; Joining chain of multimeric IgA and IgM |
|||||
| 3D Structure | ||||||
| Sequence |
MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNI
RIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSAT ETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPD |
|||||
| Target Bioclass |
Immunoglobulin
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces dimers and/or larger polymers. It also helps to bind these immunoglobulins to secretory component.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C91(1.74); C131(1.41); C94(1.24); C114(1.24) | LDD0304 | [1] | |
|
DBIA Probe Info |
 |
C131(1.90); C91(1.84); C156(1.25) | LDD3377 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C91(0.95); C156(0.84); C131(0.79); C35(0.57) | LDD2187 | [3] |
| LDCM0572 | Fragment10 | Ramos | C91(1.03); C156(1.11); C131(1.56); C35(1.09) | LDD2189 | [3] |
| LDCM0573 | Fragment11 | Ramos | C91(20.00); C156(2.79); C131(0.09); C35(0.30) | LDD2190 | [3] |
| LDCM0574 | Fragment12 | Ramos | C91(1.06); C156(1.09); C131(1.24); C35(0.57) | LDD2191 | [3] |
| LDCM0575 | Fragment13 | Ramos | C91(1.07); C156(1.22); C131(1.28); C35(0.70) | LDD2192 | [3] |
| LDCM0576 | Fragment14 | Ramos | C91(0.83); C156(0.94); C131(0.94); C35(0.26) | LDD2193 | [3] |
| LDCM0579 | Fragment20 | Ramos | C91(1.23); C156(0.96); C131(1.53); C35(0.50) | LDD2194 | [3] |
| LDCM0580 | Fragment21 | Ramos | C91(1.10); C156(1.16); C131(1.29); C35(1.16) | LDD2195 | [3] |
| LDCM0582 | Fragment23 | Ramos | C91(1.65); C156(1.80); C131(1.61); C35(1.21) | LDD2196 | [3] |
| LDCM0578 | Fragment27 | Ramos | C91(1.33); C156(1.01); C131(1.16); C35(0.69) | LDD2197 | [3] |
| LDCM0586 | Fragment28 | Ramos | C91(1.39); C156(0.61); C131(0.96); C35(0.39) | LDD2198 | [3] |
| LDCM0588 | Fragment30 | Ramos | C91(1.10); C156(1.56); C131(1.35); C35(0.94) | LDD2199 | [3] |
| LDCM0589 | Fragment31 | Ramos | C91(1.48); C156(1.41); C131(1.46); C35(1.58) | LDD2200 | [3] |
| LDCM0590 | Fragment32 | Ramos | C91(0.99); C156(1.06); C131(1.43); C35(0.86) | LDD2201 | [3] |
| LDCM0468 | Fragment33 | Ramos | C91(1.16); C156(1.27); C131(1.18); C35(0.90) | LDD2202 | [3] |
| LDCM0596 | Fragment38 | Ramos | C91(1.08); C156(0.97); C131(1.14); C35(0.94) | LDD2203 | [3] |
| LDCM0566 | Fragment4 | Ramos | C91(1.17); C156(0.94); C131(1.49); C35(0.73) | LDD2184 | [3] |
| LDCM0610 | Fragment52 | Ramos | C91(1.14); C156(1.27); C131(1.16); C35(0.74) | LDD2204 | [3] |
| LDCM0614 | Fragment56 | Ramos | C91(1.39); C156(1.47); C131(1.34); C35(1.27) | LDD2205 | [3] |
| LDCM0569 | Fragment7 | Ramos | C91(1.21); C156(1.01); C131(1.27); C35(0.23) | LDD2186 | [3] |
| LDCM0571 | Fragment9 | Ramos | C91(0.97); C156(1.27); C131(1.56); C35(0.88) | LDD2188 | [3] |
| LDCM0022 | KB02 | Ramos | C91(1.07); C156(0.91); C131(1.10); C35(0.32) | LDD2182 | [3] |
| LDCM0023 | KB03 | Ramos | C91(1.07); C156(0.97); C131(1.01); C35(0.37) | LDD2183 | [3] |
| LDCM0024 | KB05 | OPM-2 | C131(1.90); C91(1.84); C156(1.25) | LDD3377 | [2] |
| LDCM0131 | RA190 | MM1.R | C91(1.74); C131(1.41); C94(1.24); C114(1.24) | LDD0304 | [1] |
References