Details of the Target
General Information of Target
| Target ID | LDTP01853 | |||||
|---|---|---|---|---|---|---|
| Target Name | Somatoliberin (GHRH) | |||||
| Gene Name | GHRH | |||||
| Gene ID | 2691 | |||||
| Synonyms |
GHRF; Somatoliberin; Growth hormone-releasing factor; GRF; Growth hormone-releasing hormone; GHRH; Somatocrinin; Somatorelin; Sermorelin |
|||||
| 3D Structure | ||||||
| Sequence |
MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSR
QQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHSRNSQG |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Glucagon family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Jackson_1 Probe Info |
![]() |
20.00 | LDD0121 | [1] | |
Competitor(s) Related to This Target

