Details of the Target
General Information of Target
| Target ID | LDTP01819 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cystatin-S (CST4) | |||||
| Gene Name | CST4 | |||||
| Gene ID | 1472 | |||||
| Synonyms |
Cystatin-S; Cystatin-4; Cystatin-SA-III; Salivary acidic protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHFAISEYNKATE
DEYYRRPLQVLRAREQTFGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF EIYEVPWEDRMSLVNSRCQEA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Cystatin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
This protein strongly inhibits papain and ficin, partially inhibits stem bromelain and bovine cathepsin C, but does not inhibit porcine cathepsin B or clostripain. Papain is inhibited non-competitively.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TPP-AC Probe Info |
![]() |
N.A. | LDD0427 | [1] | |
The Interaction Atlas With This Target

