General Information of Target

Target ID LDTP01808
Target Name 2'-5'-oligoadenylate synthase 1 (OAS1)
Gene Name OAS1
Gene ID 4938
Synonyms
OIAS; 2'-5'-oligoadenylate synthase 1; (2-5')oligo(A) synthase 1; 2-5A synthase 1; EC 2.7.7.84; E18/E16; p46/p42 OAS
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE
VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL
QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW
ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR
RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
Target Bioclass
Enzyme
Family
2-5A synthase family
Subcellular location
Cytoplasm
Function
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.; [Isoform p46]: When prenylated at C-terminal, acts as a double-stranded RNA (dsRNA) sensor specifically targeted to membranous replicative organelles in SARS coronavirus-2/SARS-CoV-2 infected cells where it binds to dsRNA structures in the SARS-CoV-2 5'-UTR and initiates a potent block to SARS-CoV-2 replication. Recognizes short stretches of dsRNA and activates RNase L. The binding is remarkably specific, with two conserved stem loops in the SARS-CoV-2 5'- untranslated region (UTR) constituting the principal viral target. The same mechanism is necessary to initiate a block to cardiovirus EMCV.; [Isoform p42]: Not prenylated at C-terminal, is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication.
Uniprot ID
P00973
Ensemble ID
ENST00000202917.10
HGNC ID
HGNC:8086

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HEC1 Deletion: p.V145WfsTer15 DBIA    Probe Info 
HEC1B Deletion: p.V145WfsTer15 .
JURKAT Deletion: p.V145WfsTer15 .
NALM6 SNV: p.A347D DBIA    Probe Info 
NCIH661 SNV: p.E146Ter .
NOMO1 SNV: p.Y362H .
RD SNV: p.H378Y .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 5 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info 
K60(2.97)  LDD0277  [1]
DBIA
 Probe Info 
C54(1.47); C38(0.96)  LDD3310  [2]
IA-alkyne
 Probe Info 
C38(0.00); C177(0.00); C331(0.00); C54(0.00)  LDD0162  [3]
NAIA_4
 Probe Info 
N.A.  LDD2226  [4]
IPM
 Probe Info 
N.A.  LDD0147  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C25(0.53)  LDD2187  [6]
 LDCM0573  Fragment11 Ramos C25(1.23); C38(14.80); C331(4.25)  LDD2190  [6]
 LDCM0574  Fragment12 Ramos C25(1.11)  LDD2191  [6]
 LDCM0575  Fragment13 Ramos C25(1.08)  LDD2192  [6]
 LDCM0576  Fragment14 Ramos C25(1.21)  LDD2193  [6]
 LDCM0579  Fragment20 Ramos C25(1.08)  LDD2194  [6]
 LDCM0580  Fragment21 Ramos C25(0.80)  LDD2195  [6]
 LDCM0582  Fragment23 Ramos C25(0.88)  LDD2196  [6]
 LDCM0578  Fragment27 Ramos C25(0.69)  LDD2197  [6]
 LDCM0586  Fragment28 Ramos C25(0.34); C38(1.10); C331(3.01)  LDD2198  [6]
 LDCM0588  Fragment30 Ramos C25(0.63)  LDD2199  [6]
 LDCM0589  Fragment31 Ramos C25(1.00)  LDD2200  [6]
 LDCM0590  Fragment32 Ramos C25(0.95)  LDD2201  [6]
 LDCM0468  Fragment33 Ramos C25(1.56)  LDD2202  [6]
 LDCM0596  Fragment38 Ramos C25(0.81)  LDD2203  [6]
 LDCM0566  Fragment4 Ramos C25(0.85)  LDD2184  [6]
 LDCM0614  Fragment56 Ramos C25(1.46)  LDD2205  [6]
 LDCM0569  Fragment7 Ramos C25(4.64); C38(0.86); C331(1.37)  LDD2186  [6]
 LDCM0571  Fragment9 Ramos C25(1.10)  LDD2188  [6]
 LDCM0022  KB02 T cell C25(5.08)  LDD1703  [7]
 LDCM0023  KB03 Ramos C25(0.63); C38(0.42)  LDD2183  [6]
 LDCM0024  KB05 COLO792 C54(1.47); C38(0.96)  LDD3310  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein arginine N-methyltransferase 6 (PRMT6) Protein arginine N-methyltransferase family Q96LA8
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bardet-Biedl syndrome 4 protein (BBS4) BBS4 family Q96RK4
Exocyst complex component 5 (EXOC5) SEC10 family O00471
Other
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha-actinin-1 (ACTN1) Alpha-actinin family P12814
Conserved oligomeric Golgi complex subunit 6 (COG6) COG6 family Q9Y2V7
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379

The Drug(s) Related To This Target

Investigative
Click To Hide/Show 1 Drug(s) Interacting with This Target
Drug Name Drug Type External ID
Cysteine-s-acetamide . DB02987

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
6 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578
7 An Activity-Guided Map of Electrophile-Cysteine Interactions in Primary Human T Cells. Cell. 2020 Aug 20;182(4):1009-1026.e29. doi: 10.1016/j.cell.2020.07.001. Epub 2020 Jul 29.