Details of the Target
General Information of Target
| Target ID | LDTP01808 | |||||
|---|---|---|---|---|---|---|
| Target Name | 2'-5'-oligoadenylate synthase 1 (OAS1) | |||||
| Gene Name | OAS1 | |||||
| Gene ID | 4938 | |||||
| Synonyms |
OIAS; 2'-5'-oligoadenylate synthase 1; (2-5')oligo(A) synthase 1; 2-5A synthase 1; EC 2.7.7.84; E18/E16; p46/p42 OAS |
|||||
| 3D Structure | ||||||
| Sequence |
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVK
GGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFE VQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGGYKPNPQIYVKLIEECTDL QKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAW ERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPR RYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
2-5A synthase family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L.; [Isoform p46]: When prenylated at C-terminal, acts as a double-stranded RNA (dsRNA) sensor specifically targeted to membranous replicative organelles in SARS coronavirus-2/SARS-CoV-2 infected cells where it binds to dsRNA structures in the SARS-CoV-2 5'-UTR and initiates a potent block to SARS-CoV-2 replication. Recognizes short stretches of dsRNA and activates RNase L. The binding is remarkably specific, with two conserved stem loops in the SARS-CoV-2 5'- untranslated region (UTR) constituting the principal viral target. The same mechanism is necessary to initiate a block to cardiovirus EMCV.; [Isoform p42]: Not prenylated at C-terminal, is diffusely localized and unable to initiate a detectable block to SARS-CoV-2 replication.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HEC1 | Deletion: p.V145WfsTer15 | DBIA Probe Info | |||
| HEC1B | Deletion: p.V145WfsTer15 | . | |||
| JURKAT | Deletion: p.V145WfsTer15 | . | |||
| NALM6 | SNV: p.A347D | DBIA Probe Info | |||
| NCIH661 | SNV: p.E146Ter | . | |||
| NOMO1 | SNV: p.Y362H | . | |||
| RD | SNV: p.H378Y | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K60(2.97) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C54(1.47); C38(0.96) | LDD3310 | [2] | |
|
IA-alkyne Probe Info |
![]() |
C38(0.00); C177(0.00); C331(0.00); C54(0.00) | LDD0162 | [3] | |
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [4] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0147 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C25(0.53) | LDD2187 | [6] |
| LDCM0573 | Fragment11 | Ramos | C25(1.23); C38(14.80); C331(4.25) | LDD2190 | [6] |
| LDCM0574 | Fragment12 | Ramos | C25(1.11) | LDD2191 | [6] |
| LDCM0575 | Fragment13 | Ramos | C25(1.08) | LDD2192 | [6] |
| LDCM0576 | Fragment14 | Ramos | C25(1.21) | LDD2193 | [6] |
| LDCM0579 | Fragment20 | Ramos | C25(1.08) | LDD2194 | [6] |
| LDCM0580 | Fragment21 | Ramos | C25(0.80) | LDD2195 | [6] |
| LDCM0582 | Fragment23 | Ramos | C25(0.88) | LDD2196 | [6] |
| LDCM0578 | Fragment27 | Ramos | C25(0.69) | LDD2197 | [6] |
| LDCM0586 | Fragment28 | Ramos | C25(0.34); C38(1.10); C331(3.01) | LDD2198 | [6] |
| LDCM0588 | Fragment30 | Ramos | C25(0.63) | LDD2199 | [6] |
| LDCM0589 | Fragment31 | Ramos | C25(1.00) | LDD2200 | [6] |
| LDCM0590 | Fragment32 | Ramos | C25(0.95) | LDD2201 | [6] |
| LDCM0468 | Fragment33 | Ramos | C25(1.56) | LDD2202 | [6] |
| LDCM0596 | Fragment38 | Ramos | C25(0.81) | LDD2203 | [6] |
| LDCM0566 | Fragment4 | Ramos | C25(0.85) | LDD2184 | [6] |
| LDCM0614 | Fragment56 | Ramos | C25(1.46) | LDD2205 | [6] |
| LDCM0569 | Fragment7 | Ramos | C25(4.64); C38(0.86); C331(1.37) | LDD2186 | [6] |
| LDCM0571 | Fragment9 | Ramos | C25(1.10) | LDD2188 | [6] |
| LDCM0022 | KB02 | T cell | C25(5.08) | LDD1703 | [7] |
| LDCM0023 | KB03 | Ramos | C25(0.63); C38(0.42) | LDD2183 | [6] |
| LDCM0024 | KB05 | COLO792 | C54(1.47); C38(0.96) | LDD3310 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Protein arginine N-methyltransferase 6 (PRMT6) | Protein arginine N-methyltransferase family | Q96LA8 | |||
| Zinc finger protein RFP (TRIM27) | TRIM/RBCC family | P14373 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Bardet-Biedl syndrome 4 protein (BBS4) | BBS4 family | Q96RK4 | |||
| Exocyst complex component 5 (EXOC5) | SEC10 family | O00471 | |||
Other
References





