Details of the Target
General Information of Target
| Target ID | LDTP01672 | |||||
|---|---|---|---|---|---|---|
| Target Name | U6 snRNA-associated Sm-like protein LSm8 (LSM8) | |||||
| Gene Name | LSM8 | |||||
| Gene ID | 51691 | |||||
| Synonyms |
U6 snRNA-associated Sm-like protein LSm8 |
|||||
| 3D Structure | ||||||
| Sequence |
MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLY
IVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SnRNP Sm proteins family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C-Sul Probe Info |
 |
7.04 | LDD0066 | [1] | |
|
STPyne Probe Info |
 |
K28(14.84) | LDD2217 | [2] | |
|
Acrolein Probe Info |
 |
H96(0.00); H42(0.00) | LDD0221 | [3] | |
|
5E-2FA Probe Info |
 |
N.A. | LDD2235 | [4] | |
|
m-APA Probe Info |
 |
N.A. | LDD2231 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Superoxide dismutase [Cu-Zn] (SOD1) | Cu-Zn superoxide dismutase family | P00441 | |||
| Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) | Peptidase C12 family | P09936 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Alpha-synuclein (SNCA) | Synuclein family | P37840 | |||
Other
References