Details of the Target

General Information of Target

Target ID LDTP01463
Target Name Cyclin-dependent kinase 14 (CDK14)
Gene Name CDK14
Gene ID 5218
Synonyms
KIAA0834; PFTK1; Cyclin-dependent kinase 14; EC 2.7.11.22; Cell division protein kinase 14; Serine/threonine-protein kinase PFTAIRE-1; hPFTAIRE1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIK
PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSS
PSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR
EASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL
LRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPP
DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGV
HSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
Target Bioclass
Enzyme
Family
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily
Subcellular location
Cell membrane
Function
Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by mediating the phosphorylation of LRP6 at 'Ser-1490', leading to the activation of the Wnt signaling pathway. Acts as a regulator of cell cycle progression and cell proliferation via its interaction with CCDN3. Phosphorylates RB1 in vitro, however the relevance of such result remains to be confirmed in vivo. May also play a role in meiosis, neuron differentiation and may indirectly act as a negative regulator of insulin-responsive glucose transport.
Uniprot ID
O94921
Ensemble ID
ENST00000265741.7
HGNC ID
HGNC:8883
ChEMBL ID
CHEMBL6162

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
BT549 SNV: p.K385N .
CAL51 Deletion: p.L228CfsTer6 .
CCK81 Deletion: p.L228CfsTer6 .
CHL1 SNV: p.P124L .
COLO800 SNV: p.F332Y .
FTC133 SNV: p.Ter470WextTer30 .
HCT116 SNV: p.I321V .
IGROV1 SNV: p.P439A .
KYSE150 SNV: p.S107F .
MFE319 SNV: p.C52Ter .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		C100(1.54); C52(1.07)  LDD0304  [1]
DBIA
 Probe Info  		C402(2.29)  LDD3440  [2]
ATP probe
 Probe Info  		N.A.  LDD0199  [3]
NAIA_5
 Probe Info  		N.A.  LDD2225  [4]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-2
 Probe Info  		N.A.  LDD0139  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0625  F8 Ramos C100(0.79); C52(1.18); C402(0.65)  LDD2187  [6]
 LDCM0572  Fragment10 Ramos C100(1.80); C52(0.91); C402(0.38)  LDD2189  [6]
 LDCM0573  Fragment11 Ramos C100(0.43); C52(1.97)  LDD2190  [6]
 LDCM0574  Fragment12 Ramos C100(0.92); C52(0.75); C402(0.60)  LDD2191  [6]
 LDCM0575  Fragment13 Ramos C100(0.76); C52(0.86); C402(0.68)  LDD2192  [6]
 LDCM0576  Fragment14 Ramos C100(0.78); C52(0.85); C402(0.62)  LDD2193  [6]
 LDCM0579  Fragment20 Ramos C100(0.83); C52(0.79); C402(0.61)  LDD2194  [6]
 LDCM0580  Fragment21 Ramos C100(0.93); C52(0.81); C402(0.87)  LDD2195  [6]
 LDCM0582  Fragment23 Ramos C100(1.64); C52(0.92); C402(0.37)  LDD2196  [6]
 LDCM0578  Fragment27 Ramos C100(1.06); C52(0.82); C402(0.86)  LDD2197  [6]
 LDCM0586  Fragment28 Ramos C100(0.65); C52(0.79); C402(0.42)  LDD2198  [6]
 LDCM0588  Fragment30 Ramos C100(1.42); C52(0.90); C402(0.77)  LDD2199  [6]
 LDCM0589  Fragment31 Ramos C100(0.88); C52(0.74); C402(0.81)  LDD2200  [6]
 LDCM0590  Fragment32 Ramos C100(1.46); C52(1.01); C402(0.49)  LDD2201  [6]
 LDCM0468  Fragment33 Ramos C100(1.38); C52(0.85); C402(0.78)  LDD2202  [6]
 LDCM0596  Fragment38 Ramos C100(1.54); C52(0.73); C402(0.89)  LDD2203  [6]
 LDCM0566  Fragment4 Ramos C100(0.95); C52(1.01); C402(0.60)  LDD2184  [6]
 LDCM0610  Fragment52 Ramos C100(1.48); C52(0.81); C402(0.76)  LDD2204  [6]
 LDCM0614  Fragment56 Ramos C100(1.20); C52(0.69); C402(0.70)  LDD2205  [6]
 LDCM0569  Fragment7 Ramos C100(0.66); C52(1.26); C402(0.42)  LDD2186  [6]
 LDCM0571  Fragment9 Ramos C100(1.04); C52(0.88); C402(0.75)  LDD2188  [6]
 LDCM0022  KB02 Ramos C100(1.31); C52(1.86); C402(0.34)  LDD2182  [6]
 LDCM0023  KB03 Ramos C100(0.73); C52(1.07); C402(0.41)  LDD2183  [6]
 LDCM0024  KB05 SNU-245 C402(2.29)  LDD3440  [2]
 LDCM0131  RA190 MM1.R C100(1.54); C52(1.07)  LDD0304  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein epsilon (YWHAE) 14-3-3 family P62258
14-3-3 protein theta (YWHAQ) 14-3-3 family P27348
Heat shock protein HSP 90-beta (HSP90AB1) Heat shock protein 90 family P08238
Other
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein beta/alpha (YWHAB) 14-3-3 family P31946
14-3-3 protein eta (YWHAH) 14-3-3 family Q04917
Cyclin-dependent kinase inhibitor 1 (CDKN1A) CDI family P38936
G1/S-specific cyclin-D3 (CCND3) Cyclin family P30281
Cyclin-Y (CCNY) Cyclin family Q8ND76

References

1 Physical and Functional Analysis of the Putative Rpn13 Inhibitor RA190. Cell Chem Biol. 2020 Nov 19;27(11):1371-1382.e6. doi: 10.1016/j.chembiol.2020.08.007. Epub 2020 Aug 27.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
4 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
5 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.
6 Site-specific quantitative cysteine profiling with data-independent acquisition-based mass spectrometry. Methods Enzymol. 2023;679:295-322. doi: 10.1016/bs.mie.2022.07.037. Epub 2022 Sep 7.
Mass spectrometry data entry: PXD027578