Details of the Target
General Information of Target
| Target ID | LDTP01411 | |||||
|---|---|---|---|---|---|---|
| Target Name | Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 (B3GAT3) | |||||
| Gene Name | B3GAT3 | |||||
| Gene ID | 26229 | |||||
| Synonyms |
Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3; EC 2.4.1.135; Beta-1,3-glucuronyltransferase 3; Glucuronosyltransferase I; GlcAT-I; UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase; GlcUAT-I
|
|||||
| 3D Structure | ||||||
| Sequence |
MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRR
PPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPL VSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKD PPPPGTQGVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFH TAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHLESSLLSHLVDPKDLEPRAAN CTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycosyltransferase 43 family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Glycosaminoglycans biosynthesis. Involved in forming the linkage tetrasaccharide present in heparan sulfate and chondroitin sulfate. Transfers a glucuronic acid moiety from the uridine diphosphate-glucuronic acid (UDP-GlcUA) to the common linkage region trisaccharide Gal-beta-1,3-Gal-beta-1,4-Xyl covalently bound to a Ser residue at the glycosaminylglycan attachment site of proteoglycans. Can also play a role in the biosynthesis of l2/HNK-1 carbohydrate epitope on glycoproteins. Shows strict specificity for Gal-beta-1,3-Gal-beta-1,4-Xyl, exhibiting negligible incorporation into other galactoside substrates including Galbeta1-3Gal beta1-O-benzyl, Galbeta1-4GlcNAc and Galbeta1-4Glc. Stimulates 2-phosphoxylose phosphatase activity of PXYLP1 in presence of uridine diphosphate-glucuronic acid (UDP-GlcUA) during completion of linkage region formation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
CY4 Probe Info |
![]() |
Q321(0.00); Q323(0.00); Q325(0.00) | LDD0247 | [1] | |

