Details of the Target
General Information of Target
| Target ID | LDTP01395 | |||||
|---|---|---|---|---|---|---|
| Target Name | CCN family member 5 (CCN5) | |||||
| Gene Name | CCN5 | |||||
| Gene ID | 8839 | |||||
| Synonyms |
CT58; CTGFL; WISP2; CCN family member 5; Connective tissue growth factor-like protein; CTGF-L; Connective tissue growth factor-related protein 58; WNT1-inducible-signaling pathway protein 2; WISP-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRL
GEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIR CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQ FSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPS RGRSPQNSAF |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CCN family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
May play an important role in modulating bone turnover. Promotes the adhesion of osteoblast cells and inhibits the binding of fibrinogen to integrin receptors. In addition, inhibits osteocalcin production.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
C117(1.34) | LDD2230 | [1] | |
|
BTD Probe Info |
 |
C117(0.54) | LDD2091 | [2] | |
|
DBIA Probe Info |
 |
C39(10.20); C237(4.99); C64(3.03) | LDD2236 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0519 | 1-(6-methoxy-3,4-dihydroquinolin-1(2H)-yl)-2-nitroethan-1-one | MDA-MB-231 | C117(0.95) | LDD2112 | [2] |
| LDCM0524 | 2-Cyano-N-(2-morpholin-4-yl-ethyl)-acetamide | MDA-MB-231 | C117(0.91) | LDD2117 | [2] |
| LDCM0510 | 3-(4-(Hydroxydiphenylmethyl)piperidin-1-yl)-3-oxopropanenitrile | MDA-MB-231 | C117(1.10) | LDD2103 | [2] |
| LDCM0545 | Acetamide | MDA-MB-231 | C117(0.26) | LDD2138 | [2] |
| LDCM0498 | BS-3668 | MDA-MB-231 | C117(0.54) | LDD2091 | [2] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C117(0.90) | LDD2092 | [2] |
| LDCM0501 | Nucleophilic fragment 13b | MDA-MB-231 | C117(0.69) | LDD2094 | [2] |
| LDCM0505 | Nucleophilic fragment 15b | MDA-MB-231 | C117(1.02) | LDD2098 | [2] |
| LDCM0516 | Nucleophilic fragment 21a | MDA-MB-231 | C117(1.01) | LDD2109 | [2] |
| LDCM0532 | Nucleophilic fragment 29a | MDA-MB-231 | C117(0.86) | LDD2125 | [2] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C117(0.69) | LDD2141 | [2] |
| LDCM0556 | Nucleophilic fragment 8a | MDA-MB-231 | C117(0.54) | LDD2150 | [2] |
References