Details of the Target

General Information of Target

Target ID LDTP01376
Target Name Keratin, type I cuticular Ha6 (KRT36)
Gene Name KRT36
Gene ID 8689
Synonyms
HHA6; HKA6; KRTHA6; Keratin, type I cuticular Ha6; Hair keratin, type I Ha6; Keratin-36; K36
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSARSGLSGLG
SCLPGSYLSSECHTSGFVGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAE
LESRIQEWYEFQIPYICPDYQSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDFRT
KYETELSLRQLVEADINGLRRILDELTLCKADLEAQVESLKEELMCLKKNHEEEVSVLRC
QLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTEELNQQVVSSSE
QLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLAQMQCLISNVEA
QLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVP
SVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL
Target Bioclass
Other
Family
Intermediate filament family
Uniprot ID
O76013
Ensemble ID
ENST00000328119.11
HGNC ID
HGNC:6454

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
AN3CA SNV: p.E86D .
Ishikawa (Heraklio) 02 ER SNV: p.G24V .
MEWO Substitution: p.G35N .
MFE319 SNV: p.Q374R .
NCIH1793 SNV: p.L59I .
NCIH2291 SNV: p.A22S .
NCIH358 SNV: p.A338V; p.K383N .
WM793 SNV: p.E218K
Substitution: p.E311L		 .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
SAHA-CA-4PAP
 Probe Info  		N.A.  LDD0361  [1]
IA-alkyne
 Probe Info  		N.A.  LDD2241  [2]
PAL-AfBPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STS-1
 Probe Info  		N.A.  LDD0137  [3]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0096  SAHA K562 N.A.  LDD0361  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cell division cycle protein 23 homolog (CDC23) APC8/CDC23 family Q9UJX2
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
GTP-binding protein GEM (GEM) RGK family P55040
TNF receptor-associated factor 4 (TRAF4) TNF receptor-associated factor family Q9BUZ4
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Exocyst complex component 8 (EXOC8) EXO84 family Q8IYI6
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein 414 (ZNF414) Krueppel C2H2-type zinc-finger protein family Q96IQ9
Zinc finger protein 785 (ZNF785) Krueppel C2H2-type zinc-finger protein family A8K8V0
Other
Click To Hide/Show 28 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ABI gene family member 3 (ABI3) ABI family Q9P2A4
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Keratin, type II cytoskeletal 1b (KRT77) Intermediate filament family Q7Z794
Keratin, type II cytoskeletal 2 epidermal (KRT2) Intermediate filament family P35908
Keratin, type II cytoskeletal 2 oral (KRT76) Intermediate filament family Q01546
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Keratin, type II cytoskeletal 4 (KRT4) Intermediate filament family P19013
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin, type II cytoskeletal 78 (KRT78) Intermediate filament family Q8N1N4
Keratin, type II cytoskeletal 79 (KRT79) Intermediate filament family Q5XKE5
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Myozenin-1 (MYOZ1) Myozenin family Q9NP98
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
RIB43A-like with coiled-coils protein 1 (RIBC1) RIB43A family Q8N443
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Alpha-taxilin (TXLNA) Taxilin family P40222
Thymosin beta-4 (TMSB4X) Thymosin beta family P62328
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) . Q13155
G protein pathway suppressor 2 (GPS2) . Q13227
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
Phostensin (PPP1R18) . Q6NYC8
Retroelement silencing factor 1 (RESF1) . Q9HCM1
Testis-specific protein 10-interacting protein (TSGA10IP) . Q3SY00

References

1 Streamlined Target Deconvolution Approach Utilizing a Single Photoreactive Chloroalkane Capture Tag. ACS Chem Biol. 2021 Feb 19;16(2):404-413. doi: 10.1021/acschembio.0c00987. Epub 2021 Feb 5.
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
3 Design and synthesis of minimalist terminal alkyne-containing diazirine photo-crosslinkers and their incorporation into kinase inhibitors for cell- and tissue-based proteome profiling. Angew Chem Int Ed Engl. 2013 Aug 12;52(33):8551-6. doi: 10.1002/anie.201300683. Epub 2013 Jun 10.