Details of the Target

General Information of Target

Target ID LDTP01375
Target Name Keratin, type I cuticular Ha4 (KRT34)
Gene Name KRT34
Gene ID 100653049
Synonyms
HHA4; HKA4; KRTHA4; Keratin, type I cuticular Ha4; Hair keratin, type I Ha4; Keratin-34; K34
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSYSCCLPSLGCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELEKLIQERSQQQEPLLCPSYQSYFKTIEELQQKILCA
KAENARLVVNIDNAKLASDDFRSKYQTEQSLRLLVESDINSIRRILDELTLCKSDLESQV
ESLREELICLKKNHEEEVNTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVEINR
REVEQWFATQTEELNKQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TESEAHYSSQLSQVQSLITNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPCNPCATTNASGNSCGPCGTSQKGCCN
Target Bioclass
Other
Family
Intermediate filament family
Uniprot ID
O76011
Ensemble ID
ENST00000394001.3
HGNC ID
HGNC:6452

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
SAHA-CA-4PAP
 Probe Info  		N.A.  LDD0361  [1]
TER-AC
 Probe Info  		N.A.  LDD0426  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0096  SAHA K562 N.A.  LDD0361  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 41 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein ABHD15 (ABHD15) AB hydrolase 4 family Q6UXT9
Replication factor C subunit 5 (RFC5) Activator 1 small subunits family P40937
Aldehyde dehydrogenase family 3 member B1 (ALDH3B1) Aldehyde dehydrogenase family P43353
60 kDa heat shock protein, mitochondrial (HSPD1) Chaperonin (HSP60) family P10809
Phenylalanine--tRNA ligase, mitochondrial (FARS2) Class-II aminoacyl-tRNA synthetase family O95363
Alanine--glyoxylate aminotransferase (AGXT) Class-V pyridoxal-phosphate-dependent aminotransferase family P21549
Probable ATP-dependent RNA helicase DDX6 (DDX6) DEAD box helicase family P26196
Palmitoyltransferase ZDHHC1 (ZDHHC1) DHHC palmitoyltransferase family Q8WTX9
Ribonuclease P/MRP protein subunit POP5 (POP5) Eukaryotic/archaeal RNase P protein component 2 family Q969H6
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Hyaluronidase-2 (HYAL2) Glycosyl hydrolase 56 family Q12891
Glutathione S-transferase P (GSTP1) Pi family P09211
Inositol-trisphosphate 3-kinase B (ITPKB) Inositol phosphokinase (IPK) family P27987
Protein mab-21-like 2 (MAB21L2) Mab-21 family Q9Y586
Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein (ASMTL) Maf family O95671
Peptidoglycan recognition protein 3 (PGLYRP3) N-acetylmuramoyl-L-alanine amidase 2 family Q96LB9
ATP-dependent (S)-NAD(P)H-hydrate dehydratase (NAXD) NnrD/CARKD family Q8IW45
Ubiquitin carboxyl-terminal hydrolase 2 (USP2) Peptidase C19 family O75604
Chymotrypsin-C (CTRC) Peptidase S1 family Q99895
Kallikrein-8 (KLK8) Peptidase S1 family O60259
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Serine/threonine-protein kinase N1 (PKN1) AGC Ser/Thr protein kinase family Q16512
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Proto-oncogene serine/threonine-protein kinase mos (MOS) Ser/Thr protein kinase family P00540
Platelet-derived growth factor receptor beta (PDGFRB) Tyr protein kinase family P09619
Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 (PTPMT1) Protein-tyrosine phosphatase family Q8WUK0
Exosome complex component RRP46 (EXOSC5) RNase PH family Q9NQT4
Dehydrogenase/reductase SDR family member 1 (DHRS1) Short-chain dehydrogenases/reductases (SDR) family Q96LJ7
Ras-related protein Rab-33A (RAB33A) Rab family Q14088
Dexamethasone-induced Ras-related protein 1 (RASD1) RasD family Q9Y272
GTP-binding protein GEM (GEM) RGK family P55040
Terminal nucleotidyltransferase 5B (TENT5B) TENT family Q96A09
Tripartite motif-containing protein 42 (TRIM42) TRIM/RBCC family Q8IWZ5
Tumor susceptibility gene 101 protein (TSG101) Ubiquitin-conjugating enzyme family Q99816
Ceramide kinase (CERK) . Q8TCT0
Josephin-1 (JOSD1) . Q15040
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) . Q13526
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) . Q8N7C3
Sulfite oxidase, mitochondrial (SUOX) . P51687
Transporter and channel
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ER lumen protein-retaining receptor 1 (KDELR1) ERD2 family P24390
Exocyst complex component 8 (EXOC8) EXO84 family Q8IYI6
Hemoglobin subunit alpha (HBA1; HBA2) Globin family P69905
Organic cation/carnitine transporter 2 (SLC22A5) Organic cation transporter (TC 2.A.1.19) family O76082
Solute carrier family 15 member 2 (SLC15A2) Proton-dependent oligopeptide transporter (POT/PTR) (TC 2.A.17) family Q16348
Mitochondrial coenzyme A transporter SLC25A42 (SLC25A42) Mitochondrial carrier (TC 2.A.29) family Q86VD7
P2X purinoceptor 7 (P2RX7) P2X receptor family Q99572
AP-4 complex accessory subunit Tepsin (TEPSIN) . Q96N21
Lymphatic vessel endothelial hyaluronic acid receptor 1 (LYVE1) . Q9Y5Y7
SEC14-like protein 4 (SEC14L4) . Q9UDX3
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transmembrane protein 174 (TMEM174) . Q8WUU8
Transcription factor
Click To Hide/Show 25 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-B9 (HOXB9) Abd-B homeobox family P17482
Homeobox protein Hox-B5 (HOXB5) Antp homeobox family P09067
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
Basic leucine zipper transcriptional factor ATF-like 2 (BATF2) BZIP family Q8N1L9
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein ZIC 1 (ZIC1) GLI C2H2-type zinc-finger protein family Q15915
Zinc finger protein 124 (ZNF124) Krueppel C2H2-type zinc-finger protein family Q15973
Zinc finger protein 319 (ZNF319) Krueppel C2H2-type zinc-finger protein family Q9P2F9
Zinc finger protein 414 (ZNF414) Krueppel C2H2-type zinc-finger protein family Q96IQ9
Zinc finger protein 79 (ZNF79) Krueppel C2H2-type zinc-finger protein family Q15937
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
Homeobox protein goosecoid-2 (GSC2) Paired homeobox family O15499
Pituitary homeobox 1 (PITX1) Paired homeobox family P78337
Class E basic helix-loop-helix protein 23 (BHLHE23) . Q8NDY6
Forkhead box protein D4-like 1 (FOXD4L1) . Q9NU39
Homeobox protein notochord (NOTO) . A8MTQ0
Homeobox protein VENTX (VENTX) . O95231
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 (SMARCE1) . Q969G3
T-cell leukemia homeobox protein 3 (TLX3) . O43711
THAP domain-containing protein 7 (THAP7) . Q9BT49
Transcriptional repressor p66-alpha (GATAD2A) . Q86YP4
Zinc finger protein 580 (ZNF580) . Q9UK33
Zinc finger protein 581 (ZNF581) . Q9P0T4
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Neuropeptides B/W receptor type 2 (NPBWR2) G-protein coupled receptor 1 family P48146
Alpha-2C adrenergic receptor (ADRA2C) G-protein coupled receptor 1 family P18825
Immunoglobulin
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Semaphorin-4C (SEMA4C) Semaphorin family Q9C0C4
Tapasin-related protein (TAPBPL) . Q9BX59
Other
Click To Hide/Show 118 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Atos homolog protein B (ATOSB) ATOS family Q7L5A3
ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) ATP12 family Q8N5M1
Protein BEX1 (BEX1) BEX family Q9HBH7
Protein BEX2 (BEX2) BEX family Q9BXY8
Protein BEX3 (BEX3) BEX family Q00994
BolA-like protein 3 (BOLA3) BolA/IbaG family Q53S33
Cilia- and flagella-associated protein 206 (CFAP206) CFAP206 family Q8IYR0
Cilia- and flagella-associated protein 53 (CFAP53) CFAP53 family Q96M91
Chordin (CHRD) Chordin family Q9H2X0
Pre-mRNA-splicing factor CWC25 homolog (CWC25) CWC25 family Q9NXE8
Cyclin-C (CCNC) Cyclin family P24863
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
DNA damage-inducible transcript 4-like protein (DDIT4L) DDIT4 family Q96D03
Dedicator of cytokinesis protein 2 (DOCK2) DOCK family Q92608
Mammalian ependymin-related protein 1 (EPDR1) Ependymin family Q9UM22
Protein FAM110A (FAM110A) FAM110 family Q9BQ89
Protein FAM50B (FAM50B) FAM50 family Q9Y247
Protein FAM83A (FAM83A) FAM83 family Q86UY5
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
F-box/WD repeat-containing protein 5 (FBXW5) FBXW5 family Q969U6
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 (GNG10) G protein gamma family P50151
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 (GNG13) G protein gamma family Q9P2W3
Golgi-associated RAB2 interactor protein 6 (GARIN6) GARIN family Q8NEG0
Gastrin (GAST) Gastrin/cholecystokinin family P01350
Progranulin (GRN) Granulin family P28799
Heat shock 70 kDa protein 12B (HSPA12B) Heat shock protein 70 family Q96MM6
Integrin beta-5 (ITGB5) Integrin beta chain family P18084
Keratin, type I cytoskeletal 20 (KRT20) Intermediate filament family P35900
Keratin, type II cuticular Hb1 (KRT81) Intermediate filament family Q14533
Keratin, type II cuticular Hb2 (KRT82) Intermediate filament family Q9NSB4
Keratin, type II cuticular Hb3 (KRT83) Intermediate filament family P78385
Keratin, type II cuticular Hb5 (KRT85) Intermediate filament family P78386
Keratin, type II cuticular Hb6 (KRT86) Intermediate filament family O43790
Keratin, type II cytoskeletal 1 (KRT1) Intermediate filament family P04264
Keratin, type II cytoskeletal 3 (KRT3) Intermediate filament family P12035
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 6C (KRT6C) Intermediate filament family P48668
Keratin, type II cytoskeletal 71 (KRT71) Intermediate filament family Q3SY84
Keratin, type II cytoskeletal 74 (KRT74) Intermediate filament family Q7RTS7
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Keratin, type II cytoskeletal 78 (KRT78) Intermediate filament family Q8N1N4
Keratin, type II cytoskeletal 79 (KRT79) Intermediate filament family Q5XKE5
Keratin, type II cytoskeletal 8 (KRT8) Intermediate filament family P05787
Kinesin light chain 4 (KLC4) Kinesin light chain family Q9NSK0
Keratin-associated protein 12-2 (KRTAP12-2) KRTAP type 12 family P59991
Keratin-associated protein 19-5 (KRTAP19-5) KRTAP type 19 family Q3LI72
Keratin-associated protein 19-7 (KRTAP19-7) KRTAP type 19 family Q3SYF9
Plasmolipin (PLLP) MAL family Q9Y342
Methyl-CpG-binding domain protein 3-like 2 (MBD3L2) MBD3L family Q8NHZ7
Large ribosomal subunit protein mL64 (GADD45GIP1) Mitochondrion-specific ribosomal protein mL64 family Q8TAE8
Meiosis-specific nuclear structural protein 1 (MNS1) MNS1 family Q8NEH6
Myozenin-1 (MYOZ1) Myozenin family Q9NP98
Myozenin-3 (MYOZ3) Myozenin family Q8TDC0
NGFI-A-binding protein 2 (NAB2) NAB family Q15742
Iron-sulfur cluster assembly enzyme ISCU (ISCU) NifU family Q9H1K1
Neuromedin-U (NMU) NmU family P48645
Keratin-associated protein 26-1 (KRTAP26-1) PMG family Q6PEX3
Pre-mRNA-splicing factor 18 (PRPF18) PRP18 family Q99633
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31) PRP31 family Q8WWY3
Ras and Rab interactor 1 (RIN1) RIN (Ras interaction/interference) family Q13671
Protein ripply1 (RIPPLY1) Ripply family Q0D2K3
Guanine nucleotide exchange factor for Rab-3A (RAB3IL1) SEC2 family Q8TBN0
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Nonsense-mediated mRNA decay factor SMG9 (SMG9) SMG9 family Q9H0W8
SOSS complex subunit C (INIP) SOSS-C family Q9NRY2
Pre-mRNA-splicing factor SPF27 (BCAS2) SPF27 family O75934
Protein sprouty homolog 3 (SPRY3) Sprouty family O43610
Stathmin-3 (STMN3) Stathmin family Q9NZ72
Translational activator of cytochrome c oxidase 1 (TACO1) TACO1 family Q9BSH4
Alpha-taxilin (TXLNA) Taxilin family P40222
Beta-taxilin (TXLNB) Taxilin family Q8N3L3
Trichoplein keratin filament-binding protein (TCHP) TCHP family Q9BT92
Tektin-3 (TEKT3) Tektin family Q9BXF9
Tektin-4 (TEKT4) Tektin family Q8WW24
Thymosin beta-4 (TMSB4X) Thymosin beta family P62328
Tetratricopeptide repeat protein 9C (TTC9C) TTC9 family Q8N5M4
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
U3 small nucleolar RNA-associated protein 14 homolog C (UTP14C) UTP14 family Q5TAP6
rRNA-processing protein UTP23 homolog (UTP23) UTP23/FCF1 family Q9BRU9
Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) . Q13155
APOBEC1 complementation factor (A1CF) . Q9NQ94
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
BTB/POZ domain-containing protein KCTD9 (KCTD9) . Q7L273
C-type lectin domain family 18 member A (CLEC18A) . A5D8T8
Chromobox protein homolog 8 (CBX8) . Q9HC52
Cilia- and flagella-associated protein 90 (CFAP90) . A4QMS7
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Coiled-coil domain-containing protein 24 (CCDC24) . Q8N4L8
Cytohesin-4 (CYTH4) . Q9UIA0
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
Fibronectin type III domain-containing protein 11 (FNDC11) . Q9BVV2
G protein pathway suppressor 2 (GPS2) . Q13227
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
INO80 complex subunit B (INO80B) . Q9C086
Kelch-like protein 38 (KLHL38) . Q2WGJ6
KN motif and ankyrin repeat domain-containing protein 2 (KANK2) . Q63ZY3
Leucine-rich repeat-containing protein 41 (LRRC41) . Q15345
LIM domain transcription factor LMO4 (LMO4) . P61968
LysM and putative peptidoglycan-binding domain-containing protein 1 (LYSMD1) . Q96S90
Matrin-3 (MATR3) . P43243
Midnolin (MIDN) . Q504T8
Migration and invasion-inhibitory protein (MIIP) . Q5JXC2
Mitogen-activated protein kinase-binding protein 1 (MAPKBP1) . O60336
Mitotic spindle assembly checkpoint protein MAD2B (MAD2L2) . Q9UI95
Phostensin (PPP1R18) . Q6NYC8
Proline-rich protein 35 (PRR35) . P0CG20
Protein phosphatase 1 regulatory subunit 27 (PPP1R27) . Q86WC6
R3H domain-containing protein 2 (R3HDM2) . Q9Y2K5
Receptor-transporting protein 5 (RTP5) . Q14D33
SHC-transforming protein 3 (SHC3) . Q92529
Sperm mitochondrial-associated cysteine-rich protein (SMCP) . P49901
Spermatogenesis-associated protein 46 (SPATA46) . Q5T0L3
Sterile alpha motif domain-containing protein 11 (SAMD11) . Q96NU1
TBC1 domain family member 22B (TBC1D22B) . Q9NU19
Uncharacterized protein C11orf87 (C11orf87) . Q6NUJ2
Uncharacterized protein C17orf50 (C17orf50) . Q8WW18

References

1 Streamlined Target Deconvolution Approach Utilizing a Single Photoreactive Chloroalkane Capture Tag. ACS Chem Biol. 2021 Feb 19;16(2):404-413. doi: 10.1021/acschembio.0c00987. Epub 2021 Feb 5.
2 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.