Details of the Target

General Information of Target

Target ID LDTP01354
Target Name Small EDRK-rich factor 1 (SERF1A; SERF1B)
Gene Name SERF1A; SERF1B
Gene ID 728492
Synonyms
FAM2A; SERF1; SMAM1; FAM2B; SERF1; SMAM1; Small EDRK-rich factor 1; Protein 4F5; h4F5; SMA modifier 1
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAP
RENPCFPLPAAGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI
Target Bioclass
Other
Family
SERF family
Subcellular location
Cytoplasm, cytosol
Function
Positive regulator of amyloid protein aggregation and proteotoxicity. Induces conformational changes in amyloid proteins, such as APP, HTT, and SNCA, driving them into compact formations preceding the formation of aggregates.
Uniprot ID
O75920
Ensemble ID
ENST00000317633.14
HGNC ID
HGNC:10755

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C65(0.98)  LDD1512  [1]
TFBX
 Probe Info  		N.A.  LDD0027  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0259  AC14 HEK-293T C65(0.98)  LDD1512  [1]
 LDCM0282  AC22 HEK-293T C65(0.96)  LDD1521  [1]
 LDCM0291  AC30 HEK-293T C65(0.98)  LDD1530  [1]
 LDCM0299  AC38 HEK-293T C65(1.18)  LDD1538  [1]
 LDCM0308  AC46 HEK-293T C65(0.92)  LDD1547  [1]
 LDCM0317  AC54 HEK-293T C65(1.08)  LDD1556  [1]
 LDCM0323  AC6 HEK-293T C65(0.94)  LDD1562  [1]
 LDCM0326  AC62 HEK-293T C65(1.10)  LDD1565  [1]
 LDCM0368  CL10 HEK-293T C65(1.01)  LDD1572  [1]
 LDCM0410  CL22 HEK-293T C65(1.10)  LDD1614  [1]
 LDCM0423  CL34 HEK-293T C65(1.07)  LDD1627  [1]
 LDCM0436  CL46 HEK-293T C65(1.07)  LDD1640  [1]
 LDCM0449  CL58 HEK-293T C65(1.14)  LDD1652  [1]
 LDCM0463  CL70 HEK-293T C65(1.26)  LDD1666  [1]
 LDCM0476  CL82 HEK-293T C65(1.10)  LDD1679  [1]
 LDCM0489  CL94 HEK-293T C65(0.97)  LDD1692  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Phosphatidylserine lipase ABHD16A (ABHD16A) ABHD16 family O95870
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Very long chain fatty acid elongase 7 (ELOVL7) ELO family A1L3X0
Ribonuclease kappa (RNASEK) RNase K family Q6P5S7
Ceramide synthase 4 (CERS4) . Q9HA82
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Alpha-synuclein (SNCA) Synuclein family P37840
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Other
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Complex I assembly factor TIMMDC1, mitochondrial (TIMMDC1) Tim17/Tim22/Tim23 family Q9NPL8

References

1 Accelerating multiplexed profiling of protein-ligand interactions: High-throughput plate-based reactive cysteine profiling with minimal input. Cell Chem Biol. 2024 Mar 21;31(3):565-576.e4. doi: 10.1016/j.chembiol.2023.11.015. Epub 2023 Dec 19.
Mass spectrometry data entry: PXD044402
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255