Details of the Target
General Information of Target
| Target ID | LDTP01218 | |||||
|---|---|---|---|---|---|---|
| Target Name | Vacuolar protein sorting-associated protein 26A (VPS26A) | |||||
| Gene Name | VPS26A | |||||
| Gene ID | 9559 | |||||
| Synonyms |
VPS26; Vacuolar protein sorting-associated protein 26A; Vesicle protein sorting 26A; hVPS26 |
|||||
| 3D Structure | ||||||
| Sequence |
MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPG
KRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYES YIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEY NKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAP VKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPE KLRKQRTNFHQRFESPESQASAEQPEM |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
VPS26 family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Acts as a component of the retromer cargo-selective complex (CSC). The CSC is believed to be the core functional component of retromer or respective retromer complex variants acting to prevent missorting of selected transmembrane cargo proteins into the lysosomal degradation pathway. The recruitment of the CSC to the endosomal membrane involves RAB7A and SNX3. The SNX-BAR retromer mediates retrograde transport of cargo proteins from endosomes to the trans-Golgi network (TGN) and is involved in endosome-to-plasma membrane transport for cargo protein recycling. The SNX3-retromer mediates the retrograde endosome-to-TGN transport of WLS distinct from the SNX-BAR retromer pathway. The SNX27-retromer is believed to be involved in endosome-to-plasma membrane trafficking and recycling of a broad spectrum of cargo proteins (Probable). The CSC seems to act as recruitment hub for other proteins, such as the WASH complex and TBC1D5 (Probable). Required for retrograde transport of lysosomal enzyme receptor IGF2R. Required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Required for the endosomal localization of WASHC2A (indicative for the WASH complex). Required for the endosomal localization of TBC1D5. Mediates retromer cargo recognition of SORL1 and is involved in trafficking of SORL1 implicated in sorting and processing of APP. Involved in retromer-independent lysosomal sorting of F2R. Involved in recycling of ADRB2. Enhances the affinity of SNX27 for PDZ-binding motifs in cargo proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
m-APA Probe Info |
![]() |
9.79 | LDD0402 | [1] | |
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [2] | |
|
HHS-475 Probe Info |
![]() |
Y157(0.92) | LDD0264 | [3] | |
|
ATP probe Probe Info |
![]() |
K242(0.00); K38(0.00) | LDD0199 | [4] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0165 | [5] | |
|
NHS Probe Info |
![]() |
N.A. | LDD0010 | [6] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [7] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [6] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [8] | |
|
AOyne Probe Info |
![]() |
7.00 | LDD0443 | [9] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [10] | |
|
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [11] | |
|
HHS-482 Probe Info |
![]() |
Y157(1.59) | LDD2239 | [12] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-1 Probe Info |
![]() |
N.A. | LDD0137 | [13] | |
|
STS-2 Probe Info |
![]() |
N.A. | LDD0138 | [13] | |
|
VE-P Probe Info |
![]() |
N.A. | LDD0396 | [14] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0156 | Aniline | NCI-H1299 | 10.55 | LDD0403 | [1] |
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [8] |
| LDCM0116 | HHS-0101 | DM93 | Y157(0.92) | LDD0264 | [3] |
| LDCM0117 | HHS-0201 | DM93 | Y157(0.70) | LDD0265 | [3] |
| LDCM0118 | HHS-0301 | DM93 | Y157(0.82) | LDD0266 | [3] |
| LDCM0119 | HHS-0401 | DM93 | Y157(0.90) | LDD0267 | [3] |
| LDCM0120 | HHS-0701 | DM93 | Y157(0.97) | LDD0268 | [3] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [8] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [8] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| NADH dehydrogenase flavoprotein 2, mitochondrial (NDUFV2) | Complex I 24 kDa subunit family | P19404 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Vacuolar protein sorting-associated protein 29 (VPS29) | VPS29 family | Q9UBQ0 | |||
| Vacuolar protein sorting-associated protein 35 (VPS35) | VPS35 family | Q96QK1 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger and SCAN domain-containing protein 12 (ZSCAN12) | Krueppel C2H2-type zinc-finger protein family | O43309 | |||
References
















