Details of the Target
General Information of Target
| Target ID | LDTP01196 | |||||
|---|---|---|---|---|---|---|
| Target Name | Adapter SH3BGRL (SH3BGRL) | |||||
| Gene Name | SH3BGRL | |||||
| Gene ID | 6451 | |||||
| Synonyms |
Adapter SH3BGRL; SH3 domain-binding glutamic acid-rich-like protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMRENVPENSRPA
TGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SH3BGR family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
Appears to function as an adapter protein that bridges proteins together or proteins with mRNAs. May function as a ubiquitin ligase-substrate adapter. Additionally, associates with translating cytoplasmic ribosomes and may promote the expression of specific mRNAs.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K17(2.50); K19(8.52) | LDD0277 | [1] | |
|
Probe 1 Probe Info |
![]() |
Y63(9.66); Y79(10.91) | LDD3495 | [2] | |
|
ATP probe Probe Info |
![]() |
K17(0.00); K18(0.00) | LDD0199 | [3] | |
|
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [4] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
C274 Probe Info |
![]() |
5.24 | LDD1944 | [5] | |
References





