General Information of Target

Target ID LDTP01091
Target Name Nucleolar protein 3 (NOL3)
Gene Name NOL3
Gene ID 8996
Synonyms
ARC; NOP; Nucleolar protein 3; Apoptosis repressor with CARD; Muscle-enriched cytoplasmic protein; Myp; Nucleolar protein of 30 kDa; Nop30
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRR
LLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGS
GTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAE
AEPEPELEPEPDPEPEPDFEERDESEDS
Target Bioclass
Other
Subcellular location
Cytoplasm; Nucleus, nucleolus
Function
[Isoform 1]: May be involved in RNA splicing.; [Isoform 2]: Functions as an apoptosis repressor that blocks multiple modes of cell death. Inhibits extrinsic apoptotic pathways through two different ways. Firstly by interacting with FAS and FADD upon FAS activation blocking death-inducing signaling complex (DISC) assembly. Secondly by interacting with CASP8 in a mitochondria localization- and phosphorylation-dependent manner, limiting the amount of soluble CASP8 available for DISC-mediated activation. Inhibits intrinsic apoptotic pathway in response to a wide range of stresses, through its interaction with BAX resulting in BAX inactivation, preventing mitochondrial dysfunction and release of pro-apoptotic factors. Inhibits calcium-mediated cell death by functioning as a cytosolic calcium buffer, dissociating its interaction with CASP8 and maintaining calcium homeostasis. Negatively regulates oxidative stress-induced apoptosis by phosphorylation-dependent suppression of the mitochondria-mediated intrinsic pathway, by blocking CASP2 activation and BAX translocation. Negatively regulates hypoxia-induced apoptosis in part by inhibiting the release of cytochrome c from mitochondria in a caspase-independent manner. Also inhibits TNF-induced necrosis by preventing TNF-signaling pathway through TNFRSF1A interaction abrogating the recruitment of RIPK1 to complex I. Finally through its role as apoptosis repressor, promotes vascular remodeling through inhibition of apoptosis and stimulation of proliferation, in response to hypoxia. Inhibits too myoblast differentiation through caspase inhibition.
Uniprot ID
O60936
Ensemble ID
ENST00000564053.5
HGNC ID
HGNC:7869

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 12 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AZ-9
 Probe Info 
D88(10.00)  LDD2209  [1]
DBIA
 Probe Info 
C73(0.96)  LDD3328  [2]
BTD
 Probe Info 
C73(1.15)  LDD2099  [3]
AHL-Pu-1
 Probe Info 
C109(2.18)  LDD0170  [4]
Acrolein
 Probe Info 
C73(0.00); C124(0.00)  LDD0222  [5]
5E-2FA
 Probe Info 
H112(0.00); H95(0.00)  LDD2235  [6]
m-APA
 Probe Info 
H112(0.00); H95(0.00)  LDD2231  [6]
IA-alkyne
 Probe Info 
N.A.  LDD0162  [7]
IPM
 Probe Info 
C109(0.00); C124(0.00)  LDD0025  [8]
NAIA_5
 Probe Info 
N.A.  LDD2225  [9]
TFBX
 Probe Info 
N.A.  LDD0027  [8]
Methacrolein
 Probe Info 
N.A.  LDD0218  [5]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0025  4SU-RNA DM93 C109(2.18)  LDD0170  [4]
 LDCM0108  Chloroacetamide HeLa C73(0.00); C124(0.00)  LDD0222  [5]
 LDCM0022  KB02 42-MG-BA C73(1.27)  LDD2244  [2]
 LDCM0023  KB03 8505C C73(1.08)  LDD2666  [2]
 LDCM0024  KB05 WM266-4 C73(0.96)  LDD3328  [2]
 LDCM0506  Nucleophilic fragment 16a MDA-MB-231 C73(1.15)  LDD2099  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Caspase-8 (CASP8) Peptidase C14A family Q14790
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cellular tumor antigen p53 (TP53) P53 family P04637
Other
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nucleolar protein 3 (NOL3) . O60936
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TERF1-interacting nuclear factor 2 (TINF2) . Q9BSI4
Ubiquilin-2 (UBQLN2) . Q9UHD9

References

1 2H-Azirine-Based Reagents for Chemoselective Bioconjugation at Carboxyl Residues Inside Live Cells. J Am Chem Soc. 2020 Apr 1;142(13):6051-6059. doi: 10.1021/jacs.9b12116. Epub 2020 Mar 23.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 Nucleophilic covalent ligand discovery for the cysteine redoxome. Nat Chem Biol. 2023 Nov;19(11):1309-1319. doi: 10.1038/s41589-023-01330-5. Epub 2023 May 29.
Mass spectrometry data entry: PXD039908 , PXD029761
4 Chemoproteomic capture of RNA binding activity in living cells. Nat Commun. 2023 Oct 7;14(1):6282. doi: 10.1038/s41467-023-41844-z.
Mass spectrometry data entry: PXD044625
5 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
6 Global profiling of functional histidines in live cells using small-molecule photosensitizer and chemical probe relay labelling. Nat Chem. 2024 Jun 4. doi: 10.1038/s41557-024-01545-6. Online ahead of print.
Mass spectrometry data entry: PXD042377
7 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
8 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
9 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264